DN621169
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN621169 vs. ExPASy Swiss-Prot
Match: NAC9_ARATH (Putative NAC domain-containing protein 9 OS=Arabidopsis thaliana GN=NAC009 PE=2 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 6.190e-17 Identity = 38/61 (62.30%), Postives = 48/61 (78.69%), Query Frame = 1 Query: 475 DERNENDKLDEIMLPPGFRFYPTDEELLGFYLRRKIQQRPLAIEPIEQIGMYKYDPWDLPK 657 D N+ D+ E +L PGFRF+PTDEEL+ FYL+RK+Q PL+IE I Q+ +YKYDPWDLPK Sbjct: 3 DRNNDGDQKMEDVLLPGFRFHPTDEELVSFYLKRKVQHNPLSIELIRQLDIYKYDPWDLPK 63
BLAST of DN621169 vs. ExPASy Swiss-Prot
Match: NAC42_ARATH (NAC domain-containing protein 42 OS=Arabidopsis thaliana GN=NAC042 PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 7.567e-15 Identity = 35/60 (58.33%), Postives = 45/60 (75.00%), Query Frame = 1 Query: 520 PGFRFYPTDEELLGFYLRRKIQQRPLAIEPIEQIGMYKYDPWDLPKCDQSLTGSVGHSTW 699 PGFRF+PTDEELLG+YLRRK++ + + +E I+QI +YKYDPWDLP+ SVG W Sbjct: 20 PGFRFHPTDEELLGYYLRRKVENKTIKLELIKQIDIYKYDPWDLPR-----VSSVGEKEW 74
BLAST of DN621169 vs. ExPASy Swiss-Prot
Match: NAC94_ARATH (Putative NAC domain-containing protein 94 OS=Arabidopsis thaliana GN=ANAC094 PE=2 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 3.755e-14 Identity = 35/78 (44.87%), Postives = 53/78 (67.95%), Query Frame = 1 Query: 475 DERNENDKLDEIMLPPGFRFYPTDEELLGFYLRRKIQQRPLAIEPIEQIGMYKYDPWDLPKCDQSLTGSVGHSTWETY 708 +E N ++ D+++LP GFRF+PTDEEL+ FYL+RK+ + L + I+++ +YKYDPWDLPK ++G W Y Sbjct: 8 EESNNVERYDDVVLP-GFRFHPTDEELVSFYLKRKVLHKSLPFDLIKKVDIYKYDPWDLPK-----LAAMGEKEWYFY 79
BLAST of DN621169 vs. ExPASy Swiss-Prot
Match: NAC72_ARATH (NAC domain-containing protein 72 OS=Arabidopsis thaliana GN=NAC072 PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 5.996e-12 Identity = 32/56 (57.14%), Postives = 40/56 (71.43%), Query Frame = 1 Query: 487 ENDKLDEIMLPPGFRFYPTDEELLGFYLRRKIQQRPLAIEPIEQIGMYKYDPWDLP 654 E D L ++ LPPGFRFYPTDEELL YL RK+ +++ I I +YK+DPWDLP Sbjct: 5 EKDPLAQLSLPPGFRFYPTDEELLVQYLCRKVAGYHFSLQVIGDIDLYKFDPWDLP 60
BLAST of DN621169 vs. ExPASy Swiss-Prot
Match: NAC68_ORYSJ (NAC domain-containing protein 68 OS=Oryza sativa subsp. japonica GN=NAC68 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.336e-11 Identity = 29/51 (56.86%), Postives = 40/51 (78.43%), Query Frame = 1 Query: 505 EIMLPPGFRFYPTDEELLGFYLRRKIQQRPLAIEPIEQIGMYKYDPWDLPK 657 E+ LPPGFRF+PTDEEL+ YL RK+ ++PL + I ++ +YK DPWDLP+ Sbjct: 18 ELNLPPGFRFHPTDEELVVHYLCRKVARQPLPVPIIAEVDLYKLDPWDLPE 68 The following BLAST results are available for this feature:
BLAST of DN621169 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DN621169 ID=DN621169; Name=DN621169; organism=Citrus sinensis; type=EST; length=710bpback to top |