DN620939
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E1311_ARATH (Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis thaliana GN=At1g32860 PE=1 SV=1) HSP 1 Score: 124.405 bits (311), Expect = 6.233e-28 Identity = 59/75 (78.67%), Postives = 67/75 (89.33%), Query Frame = -1 Query: 513 DEDEAGATPENAKKYNGNLIKLISS--KKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLG 731 D+DE GATPENAK+YNGNLIK++ S K TP++PN DL+IYVFALFNENLKPGPTSERNYGLFKPDG+ AYSLG Sbjct: 274 DDDEVGATPENAKRYNGNLIKMMMSGKKTKTPLKPNNDLSIYVFALFNENLKPGPTSERNYGLFKPDGTQAYSLG 348
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E1310_ARATH (Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis thaliana GN=At5g42100 PE=1 SV=1) HSP 1 Score: 120.168 bits (300), Expect = 1.175e-26 Identity = 56/75 (74.67%), Postives = 64/75 (85.33%), Query Frame = -1 Query: 510 DEDEAGATPENAKKYNGNLIKLISSKK-GTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLGI 731 D E GAT +NA+KYNGNLIK++ SKK TP+RP CDL I+VFALFNEN+KPGPTSERNYGLF PDG+P YSLGI Sbjct: 274 DPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGI 348
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E1314_ARATH (Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis thaliana GN=At2g27500/F10A12.18 PE=1 SV=2) HSP 1 Score: 112.464 bits (280), Expect = 2.451e-24 Identity = 49/74 (66.22%), Postives = 61/74 (82.43%), Query Frame = -1 Query: 510 DEDEAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLGI 731 DE+E GA+PENA YNGNL+KLI +KGTP + + +++YVFALFNENLKPGP SERNYGLF PDG P Y++G+ Sbjct: 275 DENEIGASPENAALYNGNLLKLIQQRKGTPAKQSVPIDVYVFALFNENLKPGPVSERNYGLFYPDGKPVYNVGM 348
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2) HSP 1 Score: 87.0409 bits (214), Expect = 1.103e-16 Identity = 40/74 (54.05%), Postives = 54/74 (72.97%), Query Frame = -1 Query: 510 DEDEAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLGI 731 D +E GA+ +NAK YNGNLI + S GTP+ P ++ Y+FAL++ENLKPGP+SER +GLFK D S Y +G+ Sbjct: 272 DANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSSERAFGLFKTDLSMVYDVGL 345
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 5.122e-14 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = -1 Query: 516 EAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSL 722 E ATPENA YN NLI+ + GTP +P ++++Y+F+LFNEN KPG SERN+G+F +G+ Y+L Sbjct: 275 ETAATPENALAYNTNLIRHVIGDPGTPAKPGEEIDVYLFSLFNENRKPGIESERNWGMFYANGTNVYAL 343
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 6.690e-14 Identity = 33/71 (46.48%), Postives = 49/71 (69.01%), Query Frame = -1 Query: 510 EAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLGI 722 + G + A+ +N +I++ SS KGTP+ PN Y+F+LF+EN KPGP +ER++GLF PD +P Y LG+ Sbjct: 276 QIGVGVQEARDFNEGMIRVCSSGKGTPLMPNRTFETYLFSLFDENQKPGPIAERHFGLFNPDFTPVYDLGL 346
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E1313_ARATH (Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis thaliana GN=At5g56590 PE=1 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 1.141e-13 Identity = 33/71 (46.48%), Postives = 51/71 (71.83%), Query Frame = -1 Query: 516 EDEAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSL 728 +++A A+ +NA+ YN N+I+ + + +GTP +P +N+Y+F+LFNEN K G SERN+GLF PD + Y L Sbjct: 274 KEKAAASSDNAETYNSNIIRHVVTNQGTPAKPGEAMNVYIFSLFNENRKAGLDSERNWGLFYPDQTSVYQL 344
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2) HSP 1 Score: 76.2554 bits (186), Expect = 1.947e-13 Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = -1 Query: 516 EAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSL 722 E AT ENA YN NLI+ + +K GTP P + Y++ L+NE+ +PGP SE+N+GLF +G+P Y+L Sbjct: 274 EHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYTNGTPVYTL 342
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E134_ARATH (Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana GN=At3g13560 PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 1.648e-12 Identity = 31/72 (43.06%), Postives = 48/72 (66.67%), Query Frame = -1 Query: 510 DEAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLGI 725 DEA AT NA+ +N NLIK + + G P +P+ +N Y++ L+NE+ + GP SERN+G+ P+G+ Y L + Sbjct: 276 DEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVYPLSL 347
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: EA6_ARATH (Probable glucan endo-1,3-beta-glucosidase A6 OS=Arabidopsis thaliana GN=A6 PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 6.262e-12 Identity = 36/74 (48.65%), Postives = 47/74 (63.51%), Query Frame = -1 Query: 516 DEDEAGATPENAKKYNGNLIKLISSKK--GTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSL 731 D DE GA NA YN NLIK +S+ GTP RP + +VF+LFNEN K G ++R++G+ PDGSP Y + Sbjct: 288 DIDETGANILNAATYNRNLIKKMSASPPIGTPSRPGLPIPTFVFSLFNENQKSGSGTQRHWGILHPDGSPIYDV 361 The following BLAST results are available for this feature:
BLAST of DN620939 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN620939 ID=DN620939; Name=DN620939; organism=Citrus sinensis; type=EST; length=731bpback to top |