DN618317
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN618317 vs. ExPASy Swiss-Prot
Match: CU66_HYACE (Larval/pupal rigid cuticle protein 66 OS=Hyalophora cecropia GN=CP66 PE=1 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 2.219e-12 Identity = 37/65 (56.92%), Postives = 44/65 (67.69%), Query Frame = 1 Query: 160 FAYEVADPISGDFKSQVEKSDGHTVRGTYSLLESDGTKRIVDYGDEGFGFTALVRKEGTPHQPAP 354 F+Y VADP +GDFKSQ+E G V+G YSLLESDGT+R VDY GF A+VRK+ AP Sbjct: 23 FSYGVADPSTGDFKSQIESRLGDNVQGQYSLLESDGTQRTVDYAAGSEGFNAVVRKDPALIAAAP 87
BLAST of DN618317 vs. ExPASy Swiss-Prot
Match: CU19_LOCMI (Cuticle protein 19 OS=Locusta migratoria PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.879e-11 Identity = 40/74 (54.05%), Postives = 44/74 (59.46%), Query Frame = 1 Query: 151 KYEFAYEVADPISGDFKSQVEKSDGHTVRGTYSLLESDGTKRIVDY-GDEGFGFTALVRKEGTPHQPAPVAPVV 369 KY F Y V DP +GD K Q E+ DG VRG YSLLE DGT R V Y D GF A+V + G PAP AP V Sbjct: 58 KYAFEYGVNDPHTGDVKRQWEERDGDVVRGEYSLLEPDGTTRTVTYTADAHNGFNAVVHRSGPSAHPAP-APAV 130
BLAST of DN618317 vs. ExPASy Swiss-Prot
Match: CU21_LOCMI (Cuticle protein 21 OS=Locusta migratoria GN=ACP21 PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.139e-11 Identity = 37/74 (50.00%), Postives = 47/74 (63.51%), Query Frame = 1 Query: 151 KYEFAYEVADPISGDFKSQVEKSDGHTVRGTYSLLESDGTKRIVDY-GDEGFGFTALVRKEGTPHQPAPVAPVV 369 +Y +AY V D ++GD K+Q E DG V+G+YSL+E DG+ R VDY D GF A+V KE H PAPV V Sbjct: 67 QYSYAYNVQDALTGDSKAQQETRDGDVVQGSYSLVEPDGSIRTVDYTADPVNGFNAVVHKEAGAH-PAPVVAKV 139 The following BLAST results are available for this feature:
BLAST of DN618317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DN618317 ID=DN618317; Name=DN618317; organism=Citrus sinensis; type=EST; length=641bpback to top |