DN617877
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DN617877 vs. ExPASy Swiss-Prot
Match: ACT3_SOYBN (Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 3.050e-11 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = -2 Query: 451 GSILASLSTFQQMWISKGEYDESGPSIVPRKCF 549 GSILASLSTFQQMWISKGEYDESGPSIV RKCF Sbjct: 344 GSILASLSTFQQMWISKGEYDESGPSIVHRKCF 376
BLAST of DN617877 vs. ExPASy Swiss-Prot
Match: ACT3_ORYSJ (Actin-3 OS=Oryza sativa subsp. japonica GN=ACT3 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.050e-11 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = -2 Query: 451 GSILASLSTFQQMWISKGEYDESGPSIVPRKCF 549 GSILASLSTFQQMWISKGEYDESGPSIV RKCF Sbjct: 345 GSILASLSTFQQMWISKGEYDESGPSIVHRKCF 377
BLAST of DN617877 vs. ExPASy Swiss-Prot
Match: ACT3_ORYSI (Actin-3 OS=Oryza sativa subsp. indica GN=ACT3 PE=2 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 3.050e-11 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = -2 Query: 451 GSILASLSTFQQMWISKGEYDESGPSIVPRKCF 549 GSILASLSTFQQMWISKGEYDESGPSIV RKCF Sbjct: 345 GSILASLSTFQQMWISKGEYDESGPSIVHRKCF 377
BLAST of DN617877 vs. ExPASy Swiss-Prot
Match: ACT2_DAUCA (Actin-2 OS=Daucus carota PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.050e-11 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = -2 Query: 451 GSILASLSTFQQMWISKGEYDESGPSIVPRKCF 549 GSILASLSTFQQMWISKGEYDESGPSIV RKCF Sbjct: 349 GSILASLSTFQQMWISKGEYDESGPSIVHRKCF 381
BLAST of DN617877 vs. ExPASy Swiss-Prot
Match: ACT13_SOLTU (Actin-101 OS=Solanum tuberosum GN=AC101 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 6.795e-11 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = -2 Query: 451 GSILASLSTFQQMWISKGEYDESGPSIVPRKCF 549 GSILASLSTFQQMWI+KGEYDESGPSIV RKCF Sbjct: 345 GSILASLSTFQQMWITKGEYDESGPSIVHRKCF 377
BLAST of DN617877 vs. ExPASy Swiss-Prot
Match: ACT12_SOLTU (Actin-100 (Fragment) OS=Solanum tuberosum GN=AC100 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 6.795e-11 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = -2 Query: 451 GSILASLSTFQQMWISKGEYDESGPSIVPRKCF 549 GSILASLSTFQQMWI+KGEYDESGPSIV RKCF Sbjct: 325 GSILASLSTFQQMWITKGEYDESGPSIVHRKCF 357 The following BLAST results are available for this feature:
BLAST of DN617877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DN617877 ID=DN617877; Name=DN617877; organism=Citrus sinensis; type=EST; length=550bpback to top |