DN617287

Overview
NameDN617287
Unique NameDN617287
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length720
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4014 contig Csv1_Contig4014:187..906. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB1_ARATH (Thioredoxin reductase 1 OS=Arabidopsis thaliana GN=NTR1 PE=1 SV=2)

HSP 1 Score: 329.717 bits (844), Expect = 9.465e-90
Identity = 162/215 (75.35%), Postives = 183/215 (85.12%), Query Frame = 3
Query:   87 MDEIQTLKTKVCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFTDSKSVLADTVIVATGAVAKKLQFPG----SDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            M+ ++T  T++CI+GSGP            ELKP+LFEGWMANDIAPGGQLTTT+DVENFPGFP+GILG +L D+ R QS RFGT IFTETV+KVDF S+PFK+FTDSK++LAD VI+ATGAVAK+L F G    S  FWNRGISACAVCDGAAPIFR+KPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRD+FRASKIMQ RAL+NPKIDVIWN
Sbjct:    1 MNGLETHNTRLCIVGSGPAAHTAAIYAARAELKPLLFEGWMANDIAPGGQLTTTTDVENFPGFPEGILGVELTDKFRKQSERFGTTIFTETVTKVDFSSKPFKLFTDSKAILADAVILATGAVAKRLSFVGSGEASGGFWNRGISACAVCDGAAPIFRNKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFRASKIMQQRALSNPKIDVIWN 215          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB2_ARATH (Thioredoxin reductase 2 OS=Arabidopsis thaliana GN=NTR2 PE=2 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 1.614e-89
Identity = 160/213 (75.12%), Postives = 184/213 (86.38%), Query Frame = 3
Query:   93 EIQTLKTKVCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFTDSKSVLADTVIVATGAVAKKLQFPGS----DAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            +++T KTKVCI+GSGP            ELKP+LFEGWMANDIAPGGQLTTT+DVENFPGFP+GILG D++++ R QS RFGT IFTETV+KVDF S+PFK+FTDS++VLAD+VI++TGAVAK+L F GS      FWNRGISACAVCDGAAPIFR+KPL VIGGGDSAMEEANFLTKYGSKVYIIHRRD+FRASKIMQ RAL+NPKI+VIWN
Sbjct:   53 DMETHKTKVCIVGSGPAAHTAAIYASRAELKPLLFEGWMANDIAPGGQLTTTTDVENFPGFPEGILGIDIVEKFRKQSERFGTTIFTETVNKVDFSSKPFKLFTDSRTVLADSVIISTGAVAKRLSFTGSGEGNGGFWNRGISACAVCDGAAPIFRNKPLVVIGGGDSAMEEANFLTKYGSKVYIIHRRDTFRASKIMQQRALSNPKIEVIWN 265          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB_DEBHA (Thioredoxin reductase OS=Debaryomyces hansenii GN=TRR1 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.571e-68
Identity = 125/205 (60.98%), Postives = 152/205 (74.15%), Query Frame = 3
Query:  117 VCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFT----DSKSVLADTVIVATGAVAKKLQFPGSDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            V IIGSGP            E+KP L+EG +AN  A GGQLTTT+DVENFPGFP+GI G +LMD+ R QS+RFGT I TET+SK D  SRPFK++T    DS+ +  D V++ATGA AK++  PG D +W +GISACAVCDGA PIFR+KPLAV+GGGDSA EEA FLTKYGSKVY++ RRD  RAS IMQ R   N K++++WN
Sbjct:    6 VTIIGSGPAAHTAAIYLSRAEIKPTLYEGMLANGTAAGGQLTTTTDVENFPGFPKGINGTELMDQMREQSVRFGTDIITETISKCDLSSRPFKLWTEWNEDSEPITTDAVVIATGASAKRMHLPGEDTYWQQGISACAVCDGAVPIFRNKPLAVVGGGDSACEEALFLTKYGSKVYLLVRRDQLRASNIMQKRVQNNDKLEILWN 210          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB1_YEAST (Thioredoxin reductase 1 OS=Saccharomyces cerevisiae GN=TRR1 PE=1 SV=3)

HSP 1 Score: 259.225 bits (661), Expect = 1.571e-68
Identity = 126/206 (61.17%), Postives = 156/206 (75.73%), Query Frame = 3
Query:  114 KVCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFT----DSKSVLADTVIVATGAVAKKLQFPGSDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            KV IIGSGP            E+KPIL+EG MAN IA GGQLTTT+++ENFPGFP G+ G +LMDR R QS +FGT+I TETVSKVD  S+PFK++T    D++ V  D +I+ATGA AK++  PG + +W +GISACAVCDGA PIFR+KPLAVIGGGDSA EEA FLTKYGSKV+++ R+D  RAS IMQ RA  N KI++++N
Sbjct:    5 KVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYN 210          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB_CANGA (Thioredoxin reductase OS=Candida glabrata GN=TRR1 PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.018e-67
Identity = 123/206 (59.71%), Postives = 154/206 (74.76%), Query Frame = 3
Query:  114 KVCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFT----DSKSVLADTVIVATGAVAKKLQFPGSDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            KV IIGSGP            E+KP ++EG +AN IA GGQLTTT+++ENFPGFP G+ G +LMDR R QS +FGT+I TET++KVD  SRPFK++T    D + +  D +++ATGA AK+L  PG + +W +GISACAVCDGA PIFR+KPLAVIGGGDSA EEA FLTKYGSKVY+I R+D  RAS IMQ RA  N KI++++N
Sbjct:    5 KVVIIGSGPAAHTAAIYLARAEIKPTMYEGMLANGIAAGGQLTTTTEIENFPGFPDGMTGSELMDRMRAQSTKFGTEIITETIAKVDLSSRPFKLWTEFNEDGEPITTDAIVIATGASAKRLHIPGEETYWQQGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVYLIVRKDHLRASTIMQRRAEQNDKIEILYN 210          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB_KLULA (Thioredoxin reductase, mitochondrial OS=Kluyveromyces lactis GN=TRR1 PE=3 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.269e-67
Identity = 124/206 (60.19%), Postives = 154/206 (74.76%), Query Frame = 3
Query:  114 KVCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFT----DSKSVLADTVIVATGAVAKKLQFPGSDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            KV IIGSGP            E+KP L+EG+MAN IA GGQLTTT+++ENFPGFP G+ G +LMDR + QS++FGT + TETVSKVD  SRPFK +T    D +    D +I++TGA AK+L  PG + +W +GISACAVCDGA PIFR+KPLAVIGGGDSA EEA FLTKYGSKVY++ R+D  RAS+IMQ RA  N KI++++N
Sbjct:   35 KVTIIGSGPAAHTAAIYLARAEIKPTLYEGFMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMKAQSIKFGTDVITETVSKVDLSSRPFKFWTEFNEDQEPETTDAIILSTGASAKRLHLPGEETYWQQGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVYMLVRKDHLRASQIMQRRAEQNEKIEILYN 240          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB_SCHPO (Thioredoxin reductase OS=Schizosaccharomyces pombe GN=trr1 PE=1 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.126e-66
Identity = 126/206 (61.17%), Postives = 149/206 (72.33%), Query Frame = 3
Query:  114 KVCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFTDSKSV----LADTVIVATGAVAKKLQFPGSDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            KV IIGSGP            ELKP+++EG +AN IA GGQLTTT+DVENFPGFP GI G  L +  R QSLRFGT+I TETVSK+D  SRPFK + +         AD+VI+ATGA A++L   G D +W  GISACAVCDGA PI+R+KPLAV+GGGDSA EEA FLTKYGSKVY++ RRD  RAS IM  R L NPK++V+WN
Sbjct:    5 KVVIIGSGPAGHTAAIYLARGELKPVMYEGMLANGIAAGGQLTTTTDVENFPGFPDGINGTTLTENFRAQSLRFGTEIITETVSKLDLSSRPFKYWLEGAEEEEPHTADSVILATGASARRLHITGEDTYWQAGISACAVCDGAVPIYRNKPLAVVGGGDSAAEEAQFLTKYGSKVYVLVRRDKLRASPIMAKRLLANPKVEVLWN 210          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB_YARLI (Thioredoxin reductase OS=Yarrowia lipolytica GN=TRR1 PE=3 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.470e-66
Identity = 123/205 (60.00%), Postives = 151/205 (73.66%), Query Frame = 3
Query:  117 VCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFT----DSKSVLADTVIVATGAVAKKLQFPGSDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            V IIGSGP            E+KP L+EG MAN IA GGQLTTT+++ENFPGFP GI+G  LM+  R QS+RFGT+I TETVSKVD   RPFK +T    D +   AD +I+ATGA AK+L  PG D +W +GISACAVCDGA PIFR+KPLAV+GGGDSA EEA FLTKYGSKVY+I R+D  RAS +M  R  ++PK+++++N
Sbjct:    6 VVIIGSGPAAHTAAIYLSRAEIKPTLYEGMMANGIAAGGQLTTTTEIENFPGFPDGIMGSQLMEDMRKQSIRFGTEIITETVSKVDLSQRPFKYWTEFNEDEEPHTADAIILATGASAKRLSLPGEDQYWQQGISACAVCDGAVPIFRNKPLAVVGGGDSAAEEALFLTKYGSKVYVIVRKDKLRASAVMAKRLASHPKVEILFN 210          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB2_YEAST (Thioredoxin reductase 2, mitochondrial OS=Saccharomyces cerevisiae GN=TRR2 PE=1 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.470e-66
Identity = 125/206 (60.68%), Postives = 152/206 (73.79%), Query Frame = 3
Query:  114 KVCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFT----DSKSVLADTVIVATGAVAKKLQFPGSDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            KV IIGSGP            E+KP L+EG MAN IA GGQLTTT+D+ENFPGFP+ + G +LM+R R QS +FGT I TETVSKVD  S+PF+++T    D++ V  D +I+ATGA AK++  PG + +W +GISACAVCDGA PIFR+KPLAVIGGGDSA EEA FLTKY SKVYI+ R+D FRAS IMQ R   NP I V++N
Sbjct:   28 KVTIIGSGPAAHTAAIYLARAEMKPTLYEGMMANGIAAGGQLTTTTDIENFPGFPESLSGSELMERMRKQSAKFGTNIITETVSKVDLSSKPFRLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAEFLTKYASKVYILVRKDHFRASVIMQRRIEKNPNIIVLFN 233          
BLAST of DN617287 vs. ExPASy Swiss-Prot
Match: TRXB_PNECA (Thioredoxin reductase OS=Pneumocystis carinii GN=TRR1 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.276e-66
Identity = 124/208 (59.62%), Postives = 152/208 (73.08%), Query Frame = 3
Query:  105 LKTKVCIIGSGPXXXXXXXXXXXXELKPILFEGWMANDIAPGGQLTTTSDVENFPGFPQGILGGDLMDRCRNQSLRFGTQIFTETVSKVDFKSRPFKVFTDSKSVL---ADTVIVATGAVAKKLQFPGSDAFWNRGISACAVCDGAAPIFRDKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDSFRASKIMQNRALTNPKIDVIWN 719
            + +KV IIGSGP            ELKPIL+EG +AN IAPGGQLTTT+DVEN+PGFP GILG  LM+  R QS ++G QI T+TVSK+D   RPFK   +S   +   AD VI+ATGA A++L  PG + +W RGISACAVCDGAAPIFR KPLAV+GGGDSA EE+ FLT+Y +KVY++ RRD  RAS IM  R L +PKI+++WN
Sbjct:    1 MHSKVVIIGSGPSGHTAAIYLGRAELKPILYEGMLANGIAPGGQLTTTTDVENYPGFPDGILGPSLMEAFRKQSEKYGAQIITDTVSKLDLSKRPFKYCCESNEEVFHTADVVILATGAYARRLNIPGEEIYWQRGISACAVCDGAAPIFRGKPLAVVGGGDSAAEESLFLTRYATKVYLLVRRDKLRASPIMAKRLLHHPKIEILWN 208          
The following BLAST results are available for this feature:
BLAST of DN617287 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
TRXB1_ARATH9.465e-9075.35Thioredoxin reductase 1 OS=Arabidopsis thaliana GN... [more]
TRXB2_ARATH1.614e-8975.12Thioredoxin reductase 2 OS=Arabidopsis thaliana GN... [more]
TRXB_DEBHA1.571e-6860.98Thioredoxin reductase OS=Debaryomyces hansenii GN=... [more]
TRXB1_YEAST1.571e-6861.17Thioredoxin reductase 1 OS=Saccharomyces cerevisia... [more]
TRXB_CANGA1.018e-6759.71Thioredoxin reductase OS=Candida glabrata GN=TRR1 ... [more]
TRXB_KLULA2.269e-6760.19Thioredoxin reductase, mitochondrial OS=Kluyveromy... [more]
TRXB_SCHPO1.126e-6661.17Thioredoxin reductase OS=Schizosaccharomyces pombe... [more]
TRXB_YARLI1.470e-6660.00Thioredoxin reductase OS=Yarrowia lipolytica GN=TR... [more]
TRXB2_YEAST1.470e-6660.68Thioredoxin reductase 2, mitochondrial OS=Saccharo... [more]
TRXB_PNECA3.276e-6659.62Thioredoxin reductase OS=Pneumocystis carinii GN=T... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A03_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617287 ID=DN617287|Name=DN617287|organism=Citrus sinensis|type=EST|length=720bp
GAACCTTTTTTGGAATTGTAACTACTTCCTCCGCCGCGGCCGCCGCTTCT
TTTTCCGCAACCACCGCTCCCAAGATCAGCAACGCCATGGACGAAATACA
AACCCTCAAGACCAAAGTCTGCATCATTGGCAGCGGCCCCGCCGCCCACA
CTGCCGCCATCTATGCCGCCCGAGCCGAGCTCAAACCCATTCTCTTCGAG
GGCTGGATGGCCAATGATATTGCGCCTGGTGGCCAACTCACCACCACCTC
CGACGTCGAGAATTTCCCCGGTTTTCCCCAGGGCATTCTCGGGGGCGACT
TGATGGATCGCTGCCGCAACCAGTCTCTCCGTTTCGGCACCCAGATTTTT
ACCGAGACCGTTTCCAAAGTCGACTTCAAATCCCGCCCTTTTAAAGTTTT
TACAGATTCCAAATCCGTTCTTGCTGATACTGTTATTGTCGCCACCGGCG
CCGTTGCCAAAAAGTTGCAATTCCCCGGTTCAGATGCGTTCTGGAACCGT
GGCATATCGGCCTGCGCAGTGTGTGATGGAGCCGCTCCGATATTTCGGGA
CAAACCCTTGGCCGTGATTGGTGGCGGGGATTCAGCCATGGAAGAAGCCA
ACTTTTTGACAAAGTACGGATCAAAAGTTTATATAATTCATAGGAGGGAT
AGTTTTAGAGCTTCGAAGATTATGCAAAACAGGGCACTTACGAACCCTAA
GATTGATGTGATTTGGAATT
back to top