DN617284

Overview
NameDN617284
Unique NameDN617284
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length551
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10467 contig Csv1_Contig10467:41..591. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 4.217e-45
Identity = 85/157 (54.14%), Postives = 116/157 (73.89%), Query Frame = -1
Query:   90 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAG---TKLNLSEKFGIVIKKKEPLVAIPTPRL 551
            L +L YL+A+VKE+FRLHP+ PL +PR ASES  I GY IPK +TL+LNVWAI RDP  W +PLEFRPERFL  G + K D  GN+F+ +PFG+GRR+CAG+ L  RM+  ++A+L+H+F W+L +G     LN+ E +G+ +++ +PLV  P PRL
Sbjct:  349 LAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLLNVWAIARDPNAWADPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNLGIRMVQLMIATLIHAFNWDLVSGQLPEMLNMEEAYGLTLQRADPLVVHPRPRL 505          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: C76A1_SOLME (Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.947e-43
Identity = 80/153 (52.29%), Postives = 103/153 (67.32%), Query Frame = -1
Query:  102 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELP---AGTKLNLSEKFGIVIKKKEPLVAIP 551
            +  L Y+ AV+KE  RLHP LPLL+PR+A +     GY IPK T +++N WAI RDP+ WDNP EF+PERFL    ESK D  G N++ +PFG+GRRMC G+PL  RM+ F   SLLH F+WELP   +   +N+ E  GI  +KK+PL  IP
Sbjct:  316 IDSLPYMQAVLKEQLRLHPPLPLLIPRKAIQDTKFMGYDIPKGTQVLVNAWAIGRDPEYWDNPFEFKPERFL----ESKVDVKGQNYELIPFGAGRRMCVGLPLGHRMMHFTFGSLLHEFDWELPHNVSPKSINMEESMGITARKKQPLKVIP 464          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: C75A1_PETHY (Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 5.699e-42
Identity = 80/155 (51.61%), Postives = 114/155 (73.55%), Query Frame = -1
Query:   90 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAGT-KLNLSEKFGIVIKKKEPLVAIPTPRL 551
            +P L YL A+ KE+FR HP+ PL +PR ++E   + GY IPK+T L +N+WAI RDPQ+W+NPLEF PERFL+ G  SK D  GN+F+ +PFG+GRR+CAG  +   M+ ++L +L+HSF+W+LP+   +LN+ E FG+ ++K  PL A+ TPRL
Sbjct:  346 IPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPQVWENPLEFNPERFLS-GRNSKIDPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWKLPSEVIELNMEEAFGLALQKAVPLEAMVTPRL 499          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.658e-41
Identity = 79/158 (50.00%), Postives = 109/158 (68.99%), Query Frame = -1
Query:   87 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAGT---KLNLSEKFGIVIKKKEPLVAIPTPRLS 551
            + +L YL AV+KE+FRLHP  PL +P  ASES  I GY IPK +TL+ N+WAI RDP  W +PL F+PERFL  G +S  D  G++F+ +PFG+GRR+CAG+ L  R + F+ A+L+  F+WEL  G    KLN+ E +G+ +++  PLV  P PRL+
Sbjct:  347 IAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGGVTPEKLNMEESYGLTLQRAVPLVVHPKPRLA 504          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 2.166e-41
Identity = 77/158 (48.73%), Postives = 115/158 (72.78%), Query Frame = -1
Query:   81 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAG-TKLNLSEKFGIVIKKKEPLVAIPTPRLSNS 551
            +P L Y  A+ KE+FR HP+ PL +PR ++E+  + G+ IPK+T L++N+WAI RDP++W+NPL+F PERFL+    +K D  GN+F+ +PFG+GRR+CAG  +    + ++L +L+HSF+W+LP G  ++N+ E FGI ++KK PL AI TPRL  S
Sbjct:  363 IPNLPYFQAICKETFRKHPSTPLNLPRISTEACEVDGFHIPKNTRLIVNIWAIGRDPKVWENPLDFTPERFLS-EKHAKIDPRGNHFELIPFGAGRRICAGARMGAASVEYILGTLVHSFDWKLPDGVVEVNMEESFGIALQKKVPLSAIVTPRLPPS 519          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: C75A3_PETHY (Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 2.166e-41
Identity = 79/155 (50.97%), Postives = 114/155 (73.55%), Query Frame = -1
Query:   90 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAGT-KLNLSEKFGIVIKKKEPLVAIPTPRL 551
            +P L YL A+ KE+FR HP+ PL +PR ++E   + GY IPK+T L +N+WAI RDP++W+NPLEF PERFL+ G  SK D  GN+F+ +PFG+GRR+CAG  +   M+ ++L +L+HSF+W+LP+   +LN+ E FG+ ++K  PL A+ TPRL
Sbjct:  346 IPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPEVWENPLEFYPERFLS-GRNSKIDPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWKLPSEVIELNMEEAFGLALQKAVPLEAMVTPRL 499          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 6.301e-41
Identity = 78/156 (50.00%), Postives = 114/156 (73.08%), Query Frame = -1
Query:   87 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAG-TKLNLSEKFGIVIKKKEPLVAIPTPRLS 551
            +P L YL A+ KE+FR HP+ PL +PR +S++ +I GY IPK+T L +N+WAI RDP +W+NPLEF PERFL+    +K ++ GN+F+ +PFG+GRR+CAG  +   M+ ++L +L+HSF+W+LP     +N+ E FG+ ++K  PL AI TPRLS
Sbjct:  349 IPNLPYLRAICKEAFRKHPSTPLNLPRVSSDACTIDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFIPERFLS-EKNAKIEHRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLIHSFDWKLPNDVVDINMEETFGLALQKAVPLEAIVTPRLS 503          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.075e-40
Identity = 81/161 (50.31%), Postives = 106/161 (65.84%), Query Frame = -1
Query:   69 LKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAGTK---LNLSEKFGIVIKKKEPLVAIPTPRLSNSELYH 542
            L YL AVVKES RLHP  PL++P +AS +  IGGY IPK   +M+NVWA+ RDP++W NPLE+RPERFL    E   D  G++F+ LPFG+GRR+C G  L   ++  ++  LLH FEW LP GT+   +N+ E  G+V     PL A+  PRL   ELY+
Sbjct:  350 LPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANVMVNVWAVARDPKVWSNPLEYRPERFL----EENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHHFEWSLPEGTRPEDVNMMESPGLVTFMGTPLQAVAKPRLEKEELYN 506          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: C75A5_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A5 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.127e-40
Identity = 77/155 (49.68%), Postives = 110/155 (70.97%), Query Frame = -1
Query:   90 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAGT-KLNLSEKFGIVIKKKEPLVAIPTPRL 551
            + KL YL A+ KE+FR HP+ PL +PR AS++  + G+ IPK T L +N+WAI RDP LW+NP EF P+RFL     +K D  GN+F+ +PFG+GRR+CAG  L   ++ ++L +L+HSF+WELP+   +LN+ E FG+ ++K  PL A+ TPRL
Sbjct:  350 ISKLPYLQAICKEAFRKHPSTPLNLPRIASQACEVNGHYIPKGTRLSVNIWAIGRDPSLWENPNEFNPDRFLE-RKNAKIDPRGNDFELIPFGAGRRICAGTRLGILLVEYILGTLVHSFDWELPSSVIELNMDEPFGLALQKAVPLAAMVTPRL 503          
BLAST of DN617284 vs. ExPASy Swiss-Prot
Match: C75A7_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A7 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.552e-39
Identity = 76/155 (49.03%), Postives = 109/155 (70.32%), Query Frame = -1
Query:   90 LPKLKYLDAVVKESFRLHPALPLLVPRRASESGSIGGYTIPKDTTLMLNVWAIHRDPQLWDNPLEFRPERFLNVGVESKFDYSGNNFQYLPFGSGRRMCAGIPLAERMLMFVLASLLHSFEWELPAGT-KLNLSEKFGIVIKKKEPLVAIPTPRL 551
            + KL YL A+ KE+FR HP+ PL +PR AS++  + G+ IPK T L +N+WAI RDP +W+NP EF P+RFL     +K D  GN+F+ +PFG+GRR+CAG  L   ++ ++L +L+HSF WELP+   +LN+ E FG+ ++K  PL A+ TPRL
Sbjct:  350 ISKLPYLQAICKEAFRKHPSTPLNLPRIASQACEVNGHYIPKGTRLSVNIWAIGRDPSVWENPNEFNPDRFLE-RKNAKIDPRGNDFELIPFGAGRRICAGTRLGILLVEYILGTLVHSFVWELPSSVIELNMDESFGLALQKAVPLAAMVTPRL 503          
The following BLAST results are available for this feature:
BLAST of DN617284 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 434
Match NameE-valueIdentityDescription
F3PH_PETHY4.217e-4554.14Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C76A1_SOLME3.947e-4352.29Cytochrome P450 76A1 (Fragment) OS=Solanum melonge... [more]
C75A1_PETHY5.699e-4251.61Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida G... [more]
F3PH_ARATH1.658e-4150.00Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C75A6_CAMME2.166e-4148.73Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]
C75A3_PETHY2.166e-4150.97Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida G... [more]
C75A2_SOLME6.301e-4150.00Flavonoid 3',5'-hydroxylase OS=Solanum melongena G... [more]
C98A1_SORBI1.075e-4050.31Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]
C75A5_EUSGR3.127e-4049.68Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C75A7_EUSGR1.552e-3949.03Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A02_f Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617284 ID=DN617284|Name=DN617284|organism=Citrus sinensis|type=EST|length=551bp
ATTAGAACTCTGAAATAACATACAAATCTCTCCGATACTCACAAAATCAT
CACAATCATTTTGTCTTAATGGTAGAGCTCTGAATTGGATAGTCTTGGTG
TTGGAATAGCAACCAAAGGCTCTTTTTTCTTAATGACAATCCCAAATTTT
TCAGATAAGTTTAGCTTTGTGCCAGCTGGCAATTCCCACTCAAATGAGTG
CAATAACGAAGCCAGAACAAACATCAGCATCCTCTCAGCTAGAGGAATCC
CAGCACACATCCTTCTACCAGAACCAAATGGCAAGTACTGAAAATTGTTA
CCTGAGTAATCGAACTTACTCTCGACACCAACATTCAGAAACCTCTCGGG
TCGAAATTCTAAGGGATTATCCCAAAGTTGAGGGTCCCTGTGGATAGCCC
AAACATTCAACATAAGAGTTGTATCTTTGGGAATGGTATAGCCACCAATG
CTGCCACTCTCACTTGCTCTGCGTGGTACTAATAAAGGCAATGCAGGATG
CAGACGAAACGATTCTTTCACCACAGCATCTAAATATTTCAATTTAGGCA
A
back to top