DN617282

Overview
NameDN617282
Unique NameDN617282
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length583
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7791 contig Csv1_Contig7791:171..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 4.123e-49
Identity = 94/96 (97.92%), Postives = 96/96 (100.00%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 3.490e-48
Identity = 92/96 (95.83%), Postives = 95/96 (98.96%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 3.490e-48
Identity = 92/96 (95.83%), Postives = 95/96 (98.96%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 5.953e-48
Identity = 90/96 (93.75%), Postives = 96/96 (100.00%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.775e-48
Identity = 90/96 (93.75%), Postives = 96/96 (100.00%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.775e-48
Identity = 90/96 (93.75%), Postives = 96/96 (100.00%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.015e-47
Identity = 89/96 (92.71%), Postives = 96/96 (100.00%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGV+KNV+KKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.859e-47
Identity = 89/96 (92.71%), Postives = 95/96 (98.96%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKFSE++TKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 6.582e-47
Identity = 90/96 (93.75%), Postives = 94/96 (97.92%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of DN617282 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 3.267e-46
Identity = 89/96 (92.71%), Postives = 92/96 (95.83%), Query Frame = -3
Query:  273 GQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 560
            GQIGNGYAPVLDCHTSHIAVKF+E+ TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETF  YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  339 GQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
The following BLAST results are available for this feature:
BLAST of DN617282 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 163
Match NameE-valueIdentityDescription
EF1A_ORYSJ4.123e-4997.92Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_SOYBN3.490e-4895.83Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_MAIZE3.490e-4895.83Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_TOBAC5.953e-4893.75Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_VICFA7.775e-4893.75Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_PEA7.775e-4893.75Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_SOLLC1.015e-4792.71Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_ARATH3.859e-4792.71Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_MANES6.582e-4793.75Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A2_DAUCA3.267e-4692.71Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A01_f Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617282 ID=DN617282|Name=DN617282|organism=Citrus sinensis|type=EST|length=583bp
ATATATCGAGCACCGACTAAATTTTCAAAATCGAGCACTAACGGCTAATC
TTGAAACAAAATGTTTGACATCCAAAAACTGGTTTATCAACTTACCAAAA
AAAAACTCTGATATAAAACCAAATTCAGAGAATTAAAATGAAGTCCCGTA
AAACAAACTAAAACACGACAAAAATAGCATAAACAGAGAAAATAAAAGCT
AACTATAGCAGATAGATCCCAAAAAACTCCTCACTTCTTCTTGGCTGCAG
ACTTGGTGACCTTGGCACCTGTTGGATCCTTCTTTTCAACATTCTTAATC
ACACCAACAGCAACAGTCTGACGCATGTCCCTAACGGCAAAACGACCAAG
AGGTGGGTAGTCAGAGAAGGTTTCAACAACCATGGGCTTGGTGGGAATCA
TCTTAACCATTCCAGCATCTCCATTCTTCAAGAACTTGGGCTCCTTCTCA
AGCTCCTTGCCTGATCGCCTATCAATCTTCGTCACGAGCTCAGAAAACTT
GACGGCAATGTGGGAGGTGTGGCAGTCAAGCACTGGGGCATATCCATTTC
CAATCTGGCCCAGGGTGGTTCATGATGATGACC
back to top