DN135279

Overview
NameDN135279
Unique NameDN135279
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length660
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_ARATH (Cytochrome c oxidase subunit 2 OS=Arabidopsis thaliana GN=COX2 PE=1 SV=2)

HSP 1 Score: 267.7 bits (683), Expect = 3.761e-71
Identity = 130/162 (80.25%), Postives = 135/162 (83.33%), Query Frame = 3
Query:  174 LLEWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            +L+WLF TI+PCDAAEPWQLGFQDAATP+MQG                       VRALWHFHYKKN IPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSL FDSYMIPE+DLELGQLRLL V
Sbjct:    3 VLKWLFFTISPCDAAEPWQLGFQDAATPIMQGIIDLHHDIFFFLILILVFVLWILVRALWHFHYKKNAIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEEDLELGQLRLLEV 164          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_OENBE (Cytochrome c oxidase subunit 2 OS=Oenothera bertiana GN=COX2 PE=3 SV=3)

HSP 1 Score: 261.536 bits (667), Expect = 2.696e-69
Identity = 129/160 (80.62%), Postives = 132/160 (82.50%), Query Frame = 3
Query:  180 EWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            E LF TIA CDAAEPWQLGFQDAATPMMQG                       VRALWHF+YKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPA+T+KAIGHQWYWTYEYSDYNSSDEQSL FDSYMIPEDDLELGQLRLL V
Sbjct:    5 ECLFFTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDILFFLILILVFVLWILVRALWHFYYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAMTLKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEV 164          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_SOYBN (Cytochrome c oxidase subunit 2 OS=Glycine max GN=COX2 PE=3 SV=2)

HSP 1 Score: 258.07 bits (658), Expect = 2.980e-68
Identity = 130/160 (81.25%), Postives = 130/160 (81.25%), Query Frame = 3
Query:  180 EWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            EWLFLTIAPCDAAEPWQLGFQDAATPMMQG                       VRALWHFHYKKNPIPQRIVHGTTIEIL TIFPSII MFIAIPSFALLYSMDEVVVDPAITIKAIGHQWY TYEYSDYNSSDEQSL FDSY IPEDDLELGQ RLL V
Sbjct:    4 EWLFLTIAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRALWHFHYKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDLELGQSRLLEV 163          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_MAIZE (Cytochrome c oxidase subunit 2 OS=Zea mays GN=COX2 PE=2 SV=4)

HSP 1 Score: 256.144 bits (653), Expect = 1.133e-67
Identity = 127/166 (76.51%), Postives = 134/166 (80.72%), Query Frame = 3
Query:  162 MIVRLLEWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            MI+RLLE  F TIA CDAAEPWQLGFQDAATPMMQG                       VRALWHF+ + NPIPQRIVHGTTIEI+WTIFPS+IL+FIAIPSFALLYSMD V+VDPAITIKAIGHQWYWTYEYSDYNSSDEQSL FDSYMIPEDDLELGQLRLL V
Sbjct:    1 MILRLLECRFFTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVLWMLVRALWHFNEQTNPIPQRIVHGTTIEIIWTIFPSVILLFIAIPSFALLYSMDGVLVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEV 166          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_BETVU (Cytochrome c oxidase subunit 2 OS=Beta vulgaris GN=COX2 PE=2 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.523e-67
Identity = 130/166 (78.31%), Postives = 133/166 (80.12%), Query Frame = 3
Query:  162 MIVRLLEWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            MIVR  EWLF T+APCDAAEPWQLGFQDAATPMMQG                       VRALWHFHYKKNPIPQRIVHGTTIEI+ TIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWY +YEYSDYNSSDEQSL FDSY IPEDD ELGQ RLL V
Sbjct:    1 MIVR--EWLFFTMAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSWILVRALWHFHYKKNPIPQRIVHGTTIEIIRTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYRSYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEV 164          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_PEA (Cytochrome c oxidase subunit 2 OS=Pisum sativum GN=COX2 PE=3 SV=2)

HSP 1 Score: 251.906 bits (642), Expect = 2.136e-66
Identity = 127/161 (78.88%), Postives = 129/161 (80.12%), Query Frame = 3
Query:  177 LEWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            LEWLFLTIAPCDAAEPWQLGFQDAATPMMQG                       VRALWHFHYKKNPIPQRIVHGTTIEIL TIFPSII MFIAIPSFALLYSMD V+VDPA+TIKAIGHQWY TYEYSDYNSSDEQSL FDSY IPEDDLELGQ  LL V
Sbjct:    3 LEWLFLTIAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRALWHFHYKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDGVLVDPAMTIKAIGHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDLELGQSGLLEV 163          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COXT_SOYBN (Cytochrome c oxidase subunit 2, mitochondrial (Fragment) OS=Glycine max GN=COX2 PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 2.790e-66
Identity = 122/165 (73.94%), Postives = 132/165 (80.00%), Query Frame = 3
Query:  165 IVRLLEWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            + R ++ +  TIAPCDAAEPWQLGFQDAATP+MQG                       +RALWHF  K NPIPQRIVHGTTIEILWTIFPS+ILMFIAIPSFALLYSMD++VVDPAITIKAIGHQWYWTYEYSDYN+SDEQSL FDSYMIPEDDLELGQLRLL V
Sbjct:  140 VSRWMDQVIPTIAPCDAAEPWQLGFQDAATPIMQGIIDLHHDIFFFVIQIGVFVSWVLLRALWHFRSKMNPIPQRIVHGTTIEILWTIFPSVILMFIAIPSFALLYSMDDIVVDPAITIKAIGHQWYWTYEYSDYNNSDEQSLAFDSYMIPEDDLELGQLRLLEV 304          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_MARPO (Cytochrome c oxidase subunit 2 OS=Marchantia polymorpha GN=COX2 PE=3 SV=3)

HSP 1 Score: 249.98 bits (637), Expect = 8.116e-66
Identity = 126/161 (78.26%), Postives = 130/161 (80.75%), Query Frame = 3
Query:  177 LEWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            L W+F  IA CDAAEPWQLGFQD ATPMMQG                       VRALWHFHYK+NPIP+RIVHGTTIEI+WTIFPSIILMFIAIPSFALLYSMDE VVDPAITIKAIGHQWYWTYEYSDYNSSDEQSL FDSYMIPEDDLELGQLRLL V
Sbjct:    3 LIWIF-PIAFCDAAEPWQLGFQDPATPMMQGIIDLHNDIFFFLIVILIFVLWMLVRALWHFHYKRNPIPERIVHGTTIEIIWTIFPSIILMFIAIPSFALLYSMDE-VVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEV 161          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_WHEAT (Cytochrome c oxidase subunit 2 OS=Triticum aestivum GN=COX2 PE=2 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.172e-64
Identity = 123/166 (74.10%), Postives = 130/166 (78.31%), Query Frame = 3
Query:  162 MIVRLLEWLFLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            MI+R L   FLTIA CDAAEPWQLGFQDAATPMMQG                       VRALWHF+ + NPIPQRIVHGTTIEI+WTIFPS+IL+FIAIPSFALLYSMD V+VDPAITIKAIGHQWYWTYEYSDYNSSDEQSL FDSY IPEDD ELGQ RLL V
Sbjct:    1 MILRSLSCRFLTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVLWMLVRALWHFNEQTNPIPQRIVHGTTIEIIWTIFPSVILLFIAIPSFALLYSMDGVLVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEV 166          
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_DAUCA (Cytochrome c oxidase subunit 2 OS=Daucus carota GN=COX2 PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 3.529e-61
Identity = 120/157 (76.43%), Postives = 122/157 (77.71%), Query Frame = 3
Query:  189 FLTIAPCDAAEPWQLGFQDAATPMMQGXXXXXXXXXXXXXXXXXXXXXXXVRALWHFHYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659
            F T +PCDAAEPWQLG QDAATPMMQG                       VRALWHFH KKNPIPQRIVHGTTIEIL TIFPSII MFIAIPSFALLYSMDEVVVDPA+TIKAIGHQWY TYEYSDYNSSDEQSL FDSY IPEDD ELGQ RLL V
Sbjct:    9 FFTNSPCDAAEPWQLGSQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRALWHFHSKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDEVVVDPAMTIKAIGHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEV 165          
The following BLAST results are available for this feature:
BLAST of DN135279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 302
Match NameE-valueIdentityDescription
COX2_ARATH3.761e-7180.25Cytochrome c oxidase subunit 2 OS=Arabidopsis thal... [more]
COX2_OENBE2.696e-6980.63Cytochrome c oxidase subunit 2 OS=Oenothera bertia... [more]
COX2_SOYBN2.980e-6881.25Cytochrome c oxidase subunit 2 OS=Glycine max GN=C... [more]
COX2_MAIZE1.133e-6776.51Cytochrome c oxidase subunit 2 OS=Zea mays GN=COX2... [more]
COX2_BETVU2.523e-6778.31Cytochrome c oxidase subunit 2 OS=Beta vulgaris GN... [more]
COX2_PEA2.136e-6678.88Cytochrome c oxidase subunit 2 OS=Pisum sativum GN... [more]
COXT_SOYBN2.790e-6673.94Cytochrome c oxidase subunit 2, mitochondrial (Fra... [more]
COX2_MARPO8.116e-6678.26Cytochrome c oxidase subunit 2 OS=Marchantia polym... [more]
COX2_WHEAT1.172e-6474.10Cytochrome c oxidase subunit 2 OS=Triticum aestivu... [more]
COX2_DAUCA3.529e-6176.43Cytochrome c oxidase subunit 2 OS=Daucus carota GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca08h12 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08h12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135279 ID=DN135279|Name=DN135279|organism=Citrus sinensis|type=EST|length=660bp
CCGGGGGCAAGNNAAGCTGACTGAGTGTTCATTAATGCCCAAAACTCCCT
NGCCTTTCTTGGTTGGACCAAGGCGATTTCTGTCTTCCTGATTTGGGATA
GTAAGAGTCAGTCTCTCTTTTTTGGGGGGGAGCAGAGCAGTCAAAGAATG
AAGCAAAGCAAATGATTGTTCGTTTACTAGAATGGTTATTCCTTACAATT
GCTCCTTGTGATGCAGCGGAACCGTGGCAATTAGGATTTCAAGACGCAGC
AACACCTATGATGCAAGGAATAATAGACTTACATCACGATATCTTCTTCT
TTCTCATTCTGATTTTGGTTTTCGTATTATGGATCTTGGTTCGTGCTTTA
TGGCATTTCCATTATAAAAAAAATCCAATCCCGCAAAGGATTGTTCATGG
AACTACTATCGAGATTCTTTGGACCATCTTTCCTAGTATCATCTTGATGT
TCATTGCTATACCATCATTTGCTCTGTTATACTCAATGGACGAGGTAGTA
GTAGATCCAGCCATCACTATCAAAGCTATTGGGCATCAATGGTATTGGAC
TTATGAGTATTCAGACTATAACAGTTCCGATGAACAGTCACTCATTTTTG
ACAGTTATATGATTCCAGAGGATGATCTAGAATTGGGTCAATTACGTTTA
TTANNNGTGG
back to top