DN135271

Overview
NameDN135271
Unique NameDN135271
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length274
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2614 contig Csv1_Contig2614:140..413. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.995e-23
Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 2
Query:   68 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTCG 265
            MSDTCGNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C  CTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.715e-19
Identity = 39/64 (60.94%), Postives = 47/64 (73.44%), Query Frame = 2
Query:   77 TCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTCGS 268
            TCGNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC  C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.836e-18
Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = 2
Query:   68 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTC 262
            MSD CGNCDCAD SQCVKKG+S   D VETD S++   VVM V AAE+ G CKCG +C CV CTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIED-VVMGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.033e-16
Identity = 38/65 (58.46%), Postives = 44/65 (67.69%), Query Frame = 2
Query:   68 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTC 262
            MS  C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.033e-16
Identity = 39/66 (59.09%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   68 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTCG 265
            MS  C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.724e-16
Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = 2
Query:   68 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTCG 265
            MSD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.724e-16
Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = 2
Query:   68 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTCG 265
            MSD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.442e-14
Identity = 33/66 (50.00%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   68 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTCG 265
            MSD CGNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of DN135271 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.588e-13
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   68 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVXCTCG 265
            MSD CG+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of DN135271 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA4.995e-2368.18Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC5.715e-1960.94Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE2.836e-1866.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV2.033e-1658.46Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO2.033e-1659.09Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ7.724e-1654.55Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI7.724e-1654.55Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ9.442e-1450.00Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI3.588e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08h04 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08h04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135271 ID=DN135271|Name=DN135271|organism=Citrus sinensis|type=EST|length=274bp
GCAAGTTTCGTACAATAAAGAGCCCTCTATTTCCAGTTTTAAGTTCTAAG
TTCTAAGCTCAATCAACATGTCGGACACCTGCGGCAACTGCGACTGCGCT
GACAGGAGCCAGTGTGTGAAGAAGGGAAGCAGCTATGCTGCTGACTTCGT
CGAGACTGACTTGAGCTTTGTCAGCACCGTTGTTGTCATGGACGTTCAGG
CTGCTGAGGCTGAAGGTAACTGCAAGTGCGGCCCCACCTGCGCTTGTGTG
NNCTGCACTTGTGGTAGTCACTAA
back to top