DN135236

Overview
NameDN135236
Unique NameDN135236
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length707
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13457 contig Csv1_Contig13457:1053..1759. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.310e-51
Identity = 102/208 (49.04%), Postives = 141/208 (67.79%), Query Frame = 2
Query:   71 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSXTAREFKQI 694
            MD +  V  LL S+IL+  L           + LPPGPT  P+IGNL  LG  PH+SLAKLAKIHGPIMSL+ GQ+TT+V SSA  A+E+L+ QD +F  R +PDA+ A+ H    + +L V T WR  R+I +S+ FS+  L+A QHLR KK+++L+AY ++   +   +HIG+AAF T+LNL+SNTIFS DL DP   + +EF+++
Sbjct:    1 MDFLIIVSTLLLSYILIWVLGV------GKPKNLPPGPTRLPIIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRNVPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCRKAALSNENVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSGKEFREV 202          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.244e-35
Identity = 82/211 (38.86%), Postives = 127/211 (60.19%), Query Frame = 2
Query:   71 MDMVSCVP-WLLFSWI---LVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATL-WRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSXTAREFK 688
            MD++S    +LLF +I    +++    SR     +  LPPGP   P+IGN+ ++G  PH S A LAKI+GPIMSLKFG + +VV +S   A+E+L+  D     R   D+I   GH E  + WLP ++  WR  RK+  +  FS ++ +A + LR KK+Q+L++++ E+     A+ I +A++ T LN+ISN +FS+DL    S  + EF+
Sbjct:    1 MDIISGQALFLLFCFISSCFLISTTARSRRSSGRAATLPPGPPRLPIIGNIHQVGKNPHSSFADLAKIYGPIMSLKFGCLNSVVITSPEAAREVLRTHDQILSGRKSNDSIRCFGHEEVSVIWLPPSSARWRMLRKLSVTLMFSPQRTEATKALRMKKVQELVSFMNESSERKEAVDISRASYTTVLNIISNILFSVDLGSYDSKKSNEFQ 211          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C76C3_ARATH (Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 2.931e-35
Identity = 73/167 (43.71%), Postives = 105/167 (62.87%), Query Frame = 2
Query:  155 SGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLA 655
            S +  LPPGP   P++GN+ +LG  PH+SLA  +K +GPIMSLK G++T VV SS   AKE L+  D     RT  DA+ A  HH+  + W+P +  WR  +K    +  S + LDA Q LR +K+++L++ V E    G AI + +A+F T+ N+ISN +FS+DLA
Sbjct:   33 SSTGTLPPGPPILPLVGNIFQLGFNPHRSLAAFSKTYGPIMSLKLGRLTAVVISSPEAAKEALRTHDHVMSARTFNDALRAFDHHKHSIVWIPPSARWRFLKKTITKYLLSPQNLDAIQSLRMRKVEELVSLVNEFRERGEAIDLARASFVTSFNIISNALFSVDLA 199          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C80B1_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.583e-33
Identity = 69/187 (36.90%), Postives = 110/187 (58.82%), Query Frame = 2
Query:  155 SGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFS---IDLADPTSXTAREFKQINWGM 706
            SG + LPPGP P+P++GNLL+LG+KPH   A+LA+ +G I +LK G  T VV S+++ A EIL+  D     R +  +    GH E  + W      W+N RK+C +  F+ + +++  H+R KK ++++ Y+ +  + G  + I +  F T +N+  N IFS    +L DP S ++ EFK+  W M
Sbjct:   23 SGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMK--KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFELGDPNSGSS-EFKEYLWRM 206          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C80B2_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.361e-32
Identity = 70/201 (34.83%), Postives = 116/201 (57.71%), Query Frame = 2
Query:  113 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFS---IDLADPTSXTAREFKQINWGM 706
            +++ ++ Y   G  SG + LPPGP P+P++GNLL+LG+KPH   A+LA+ +G I +LK G  T VV S+++ A EIL+  D     R +  +    GH E  + W      W+N RK+C +  F+ + +++  H+R KK ++++ Y+ +  + G  + I +  F T +N+  N IFS    +L  P S ++ EFK+  W M
Sbjct:   11 VIISSILYLLFG-SSGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMK--KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFELGXPNSGSS-EFKEYLWRM 207          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C76C2_ARATH (Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.757e-32
Identity = 73/200 (36.50%), Postives = 121/200 (60.50%), Query Frame = 2
Query:  101 LFSWILVVALNYFSRGFKSGSRRL---PPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWL-PVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSXTAREFK 688
            LF ++L   + +F+      SR++   PPGP   P+IGN+  +G  PH S A L+K +GPIMSLKFG + TVV +S   A+E+L+  D    +RT  ++I +  H +  + WL P ++ WR  RK+  +  FS ++++A + LR  K+++L++++ E+     A+ I +A F T LN+ISN +FS+DL +  S  +  F+
Sbjct:   12 LFCFVLSFFIIFFTTTRPRSSRKVVPSPPGPPRLPIIGNIHLVGRNPHHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTYDQILSSRTPTNSIRSINHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFMSESSEREEAVDISRATFITALNIISNILFSVDLGNYDSNKSGVFQ 211          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.664e-30
Identity = 69/189 (36.51%), Postives = 115/189 (60.85%), Query Frame = 2
Query:   98 LLFSWILVVALNYF---SRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATL-WRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDL 652
            LLF +IL   L +    S     G+  LPPGP   P+IGN+  +G  PH+S A+L+K +GP+MSLK G + TVV +S   A+E+L+  D     R+  +A+ +  H +  + WLP ++  WR  R++  +   S ++++A + LR  K+++L++++ E+     ++ I + AF TTLN+ISN +FS+DL
Sbjct:   11 LLFCFILSCFLIFTTTRSGRISRGATALPPGPPRLPIIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILSARSPTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNKVKELVSFISESSDREESVDISRVAFITTLNIISNILFSVDL 199          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C76A2_SOLME (Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.403e-29
Identity = 68/211 (32.23%), Postives = 116/211 (54.98%), Query Frame = 2
Query:   95 WLLFSWILVVA---LNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFDTTLNLISNTIFSIDLADPTSXTAREF----KQIN 697
            ++ FS I+++    L +  +     S + PPGP   P+ GN+ ELG +P+K +A L + +GP++ LK G   T+V  +A  ++E+ +N D SF NR IPD   AH +++  +   P    WR  R+IC    F  +++   + +RRK + ++L ++++   +   G+ I + +  F  + N++ N I S DLAD  S  A EF    K+IN
Sbjct:    7 YVFFSAIIILPAFILFFSQKNTTKSSYKFPPGPPGLPIFGNMFELGTEPYKKMAVLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPDVNQAHSYYQGSLAIAPYGPFWRFQRRICTIEMFVHKKISETEPVRRKCVDNMLKWIEKEANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADLESEEASEFFIAMKRIN 217          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.155e-23
Identity = 59/158 (37.34%), Postives = 96/158 (60.76%), Query Frame = 2
Query:   71 MDMVSCVPW-LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDL 541
            M+++S + + ++FS++L   L  F R  K     LPPGP P+P+IGNL+ LG KPH+S A +A+ +GP+M LK G V  VV +SA++A + L+  D +F +R          ++   + + P    WR  RKIC+ H FS++ LD  +H+R+ +++ L
Sbjct:    1 MEILSLILYTVIFSFLLQFILRSFFR--KRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAAMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTL 156          
BLAST of DN135236 vs. ExPASy Swiss-Prot
Match: C71BC_ARATH (Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.971e-23
Identity = 58/188 (30.85%), Postives = 107/188 (56.91%), Query Frame = 2
Query:  110 WILVVALNYFS-----RGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH--GHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDL 652
            W ++VA  +FS     R  +   + LPPGP   P+IGNL +LG KPH+S+ KL++ +GP+MSLKFG V+TVV S+    KE+L+  D   C+R  P+  Y     ++   + + P +  WR  RK+     ++++++ + QH R++++  L+ ++++       +++ +     + ++I    F I+L
Sbjct:    4 WYIIVAFVFFSSMIIVRIIRKTKKNLPPGPPRLPIIGNLHQLGSKPHRSMFKLSETYGPLMSLKFGSVSTVVASTPETVKEVLKTFDVECCSR--PNMTYPARVTYNLKDLCFSPYSKYWREVRKMTVVELYTAKRVQSFQHTRKEEVAALVDFIKQAASLEKPVNLNKKLMKLSGSVICRVAFGINL 189          
The following BLAST results are available for this feature:
BLAST of DN135236 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
C76B1_HELTU1.310e-5149.047-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]
C76C4_ARATH2.244e-3538.86Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C76C3_ARATH2.931e-3543.71Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CY... [more]
C80B1_ESCCA3.583e-3336.90(S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (F... [more]
C80B2_ESCCA1.361e-3234.83(S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS... [more]
C76C2_ARATH6.757e-3236.50Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CY... [more]
C76C1_ARATH1.664e-3036.51Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C76A2_SOLME2.403e-2932.23Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76... [more]
F3PH_PETHY1.155e-2337.34Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C71BC_ARATH1.971e-2330.85Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca08c09 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08c09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135236 ID=DN135236|Name=DN135236|organism=Citrus sinensis|type=EST|length=707bp
GGCCGGGGAGGGAATGCCACCTGAATTTGGTGTTTACAAGAGCTTCAAAC
AAAAGAGAGCCAGATTAAAGATGGATATGGTAAGCTGCGTACCATGGCTT
CTATTCTCGTGGATTTTGGTCGTCGCTTTAAATTATTTTTCAAGAGGATT
CAAATCTGGATCCAGAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGA
TCGGAAACCTCCTGGAACTCGGCGACAAACCTCACAAGTCACTTGCTAAA
CTTGCCAAGATTCATGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGAC
CACAGTTGTCTTTTCTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATC
AAGACACATCTTTCTGTAACCGAACGATCCCAGACGCAATCTACGCCCAC
GGCCATCATGAATTCGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAG
AAATTTTCGAAAAATATGCAACTCACATGCTTTCTCTAGTCGCCAACTCG
ATGCCAATCAGCACCTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTAT
GTCCAAGAAAATTGCCGTGCAGGTACAGCAATACATATTGGCCAAGCTGC
TTTTGACACTACGCTTAATTTGATATCCAACACAATTTTTTCTATTGACT
TGGCTGATCCCACATCNNNAACTGCGCGAGAGTTTAAGCAAATAAATTGG
GGTATGA
back to top