DN135230

Overview
NameDN135230
Unique NameDN135230
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length675
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2568 contig Csv1_Contig2568:130..804. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135230 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.103e-48
Identity = 96/97 (98.97%), Postives = 97/97 (100.00%), Query Frame = 3
Query:  159 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDMRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 449
            MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKND+RPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH
Sbjct:    1 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 97          
BLAST of DN135230 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.518e-22
Identity = 58/104 (55.77%), Postives = 71/104 (68.27%), Query Frame = 3
Query:  159 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG---TISRTGIMEKNDMRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 446
            MARS+   KLL A + DG+ +SISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID AELREMLLNH+VR+
Sbjct:    1 MARSVSSFKLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRS 104          
BLAST of DN135230 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.088e-20
Identity = 55/104 (52.88%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  159 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG---TISRTGIMEKNDMRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 446
            MARS+   K L A V D + +SISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID A+LREM+LNH+VR+
Sbjct:    1 MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRS 104          
BLAST of DN135230 vs. ExPASy Swiss-Prot
Match: ARG2_PHAAU (Indole-3-acetic acid-induced protein ARG2 OS=Phaseolus aureus GN=ARG2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.507e-11
Identity = 43/97 (44.33%), Postives = 56/97 (57.73%), Query Frame = 3
Query:  159 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG-TISRTGIMEKNDMRPAVREDS---GASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHK 437
            MARS    K+L A VADG S + +R G+AAAA    + +R G     +M P   E+    G   +W PDP+TGYYRPEN   EID A++R  +L  K
Sbjct:    1 MARSFTNVKVLSALVADGFSNTTTRHGFAAAAAATQSATRGGASIGGNMVPKSGEEKVRGGEKVSWVPDPVTGYYRPEN-TNEIDVADMRATVLGKK 96          
The following BLAST results are available for this feature:
BLAST of DN135230 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
LEA5_CITSI2.103e-4898.97Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI1.518e-2255.77Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI1.088e-2052.88Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
ARG2_PHAAU3.507e-1144.33Indole-3-acetic acid-induced protein ARG2 OS=Phase... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08c03 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08c03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135230 ID=DN135230|Name=DN135230|organism=Citrus sinensis|type=EST|length=675bp
GGCCGGGGCCTCNNNGCACAGCACAAAGAGAGCGAGCCGCTAGCTTTTGC
CTATAGCTACTGCAGGAGCAGAATCTTTCTTCTTCTGTAGTAGCACTGTA
CAGAAACATCCCAGCTAGCTATCTTCATATCTATTAAGTTCTATAGGTAA
ATAAAACAATGGCCCGCTCTCTCTTCAAAGCTAAGCTTCTTCTTGCTCCT
GTTGCTGATGGCATCTCGCTCTCCATTAGCAGGAGAGGATATGCTGCAGC
AGCACCCTTGGGGACCATATCTCGGACTGGTATCATGGAGAAAAATGATA
TGAGGCCTGCGGTGAGAGAGGATTCTGGGGCCTCTTCTGCCTGGGCCCCA
GATCCCATCACTGGGTACTACAGGCCGGAGAATCGGGCGGTCGAGATTGA
TCCAGCAGAGCTTCGAGAGATGCTGTTGAACCACAAAGTCAGGGCACACT
AGGGAGTGGTGGCGCATAGCAGCAGATCCTTTGCTGTTAGCGGTGCTTTA
ACTTTTTAAGTGATGTTGTTACAGTAGCAATTTTGACTCACTCTTAAGTC
TTTGCTGTTGTATTGATATCAACTGTTATTGACAACTTTTAATAGTGCAT
TTCCATGATTTTGTCTATTAACTTGTCAATAAAAGTAAAGNATTCCTATA
AAAAAAAAAAAAAAAAAAAAAAAAA
back to top