DN135225

Overview
NameDN135225
Unique NameDN135225
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length668
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2568 contig Csv1_Contig2568:131..798. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135225 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.523e-48
Identity = 96/97 (98.97%), Postives = 97/97 (100.00%), Query Frame = 2
Query:  158 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAKLREMLLNHKVRAH 448
            MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPA+LREMLLNHKVRAH
Sbjct:    1 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 97          
BLAST of DN135225 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.663e-22
Identity = 57/104 (54.81%), Postives = 71/104 (68.27%), Query Frame = 2
Query:  158 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG---TISRTGIMEKNDLRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAKLREMLLNHKVRA 445
            MARS+   KLL A + DG+ +SISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID A+LREMLLNH+VR+
Sbjct:    1 MARSVSSFKLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRS 104          
BLAST of DN135225 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.108e-20
Identity = 55/104 (52.88%), Postives = 68/104 (65.38%), Query Frame = 2
Query:  158 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG---TISRTGIMEKNDLRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAKLREMLLNHKVRA 445
            MARS+   K L A V D + +SISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID A LREM+LNH+VR+
Sbjct:    1 MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRS 104          
The following BLAST results are available for this feature:
BLAST of DN135225 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
LEA5_CITSI3.523e-4898.97Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI5.663e-2254.81Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI3.108e-2052.88Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08b09 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08b09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135225 ID=DN135225|Name=DN135225|organism=Citrus sinensis|type=EST|length=668bp
GCCGGGGCCTCNNNGCACAGCATAAAGAGAGCGAGCCGCTAGCTTTTGCC
TATAGCTACTGCAGGAGCAGAATCTTTCTTCTTCAGTAGTAGCACTGTAC
AGAAACATCCCAGCTAGCTATCTTCATATCTATTAAGTTCTATAAGTAAA
TAAAACAATGGCCCGCTCTCTCTTCAAAGCTAAGCTTCTTCTTGCACCTG
TTGCTGATGGCATCTCGCTCTCCATTAGCAGGAGAGGATATGCTGCAGCA
GCACCCTTGGGGACCATATCTCGGACTGGTATCATGGAGAAAAATGATTT
GAGGCCTGCGGTGAGAGAGGATTCTGGGGCCTCTTCTGCCTGGGCCCCAG
ATCCCATCACTGGGTACTACAGGCCGGAGAATCGGGCGGTCGAGATTGAT
CCAGCAAAGCTTCGAGAGATGCTGTTGAACCACAAAGTCAGGGCACACTA
GGGAGTGGTGGCGCATAGCAGCAGATCCTTTGCTGTTAGCGGTGCTTTAA
CTTTTTAAGTGATGTTGTTACAGTAGCAATTTTGACTCACTCTTAAGTCT
TTGCTGTTGTATTGATATCAACTGTTATTGACAACTTTTAATAGTGCATT
TCCATGATTTTGTCTATTNNCTTGTCAATAAAAGTAAAGAATTCCTGTAT
TGCAAAATTACTTTTATA
back to top