DN135037

Overview
NameDN135037
Unique NameDN135037
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DN135037_ssr21 microsatellite DN135037_ssr21:21..44. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5598 contig Csv1_Contig5598:1..669. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIFH_TRISP (Macrophage migration inhibitory factor homolog OS=Trichinella spiralis PE=1 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 1.078e-20
Identity = 49/115 (42.61%), Postives = 71/115 (61.74%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   ++TN+K   V  S  LS  ++ V NI+ KP +YV + +     +SFGG+  PAA+G L+SIGG+ P  N+  SA +   L KKL +PK+R +I F +  G + GWNG+TF
Sbjct:    1 MPIFTLNTNIKATDVP-SDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTKPAAFGTLMSIGGIEPSRNRDHSAKLFDHLNKKLGIPKNRMYIHFVNLNGDDVGWNGTTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIFH_TRITR (Macrophage migration inhibitory factor homolog OS=Trichuris trichiura PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 7.725e-19
Identity = 44/115 (38.26%), Postives = 70/115 (60.87%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP    STNV  + +     L   +  +A ++GKPE+YV + + G   ++FGGT+ PA +G+L+S+GG+  + N+  SA +   L   L +P +R +I F D +GS+ G+NGSTF
Sbjct:    1 MPIFTFSTNVPSENISVD-FLKSTSKLIAGMLGKPESYVAVHINGGQKITFGGTDAPAGFGQLLSLGGVGGEKNRSHSAKLFKHLTDGLGIPGNRMYINFVDMRGSDVGYNGSTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIFH_BRUMA (Macrophage migration inhibitory factor homolog OS=Brugia malayi GN=BMBAC01P19.1 PE=3 SV=4)

HSP 1 Score: 91.2781 bits (225), Expect = 5.007e-18
Identity = 47/115 (40.87%), Postives = 71/115 (61.74%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   I TN+  + + +S+ L +A++ VA  +GKPE+YV I + G   M FGG+EDP A   L SIG + P VN   +  +  +L  +L +PK+R +I+F D + S+  +NGSTF
Sbjct:    1 MPYFTIDTNIPQNSI-SSAFLKKASNVVAKALGKPESYVSIHVNGGQAMVFGGSEDPCAVCVLKSIGCVGPKVNNSHAEKLYKLLADELKIPKNRCYIEFVDIEASSMAFNGSTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIF_XENLA (Macrophage migration inhibitory factor OS=Xenopus laevis GN=mif PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.536e-17
Identity = 47/115 (40.87%), Postives = 64/115 (55.65%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   I TNV  D V   ++LS+ T  +A   GKP  Y+ I +     MSFG + DP A   L SIG +    NK  +  +  IL K+L++P +R +I +YD   +N GWNGSTF
Sbjct:    1 MPVFTIRTNVCRDSVP-DTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAVCSLCSIGKIGGPQNKSYTKLLCDILTKQLNIPANRVYINYYDLNAANVGWNGSTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIFH_WUCBA (Macrophage migration inhibitory factor homolog OS=Wuchereria bancrofti GN=MIF PE=3 SV=3)

HSP 1 Score: 86.6557 bits (213), Expect = 1.233e-16
Identity = 46/115 (40.00%), Postives = 67/115 (58.26%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   I TN   D + +S+ L +A + V   +GKPE+YV I + G  PM FGG+EDP     L SIG + P VN   +  +  +L  +L +PK+R +I+  D + S+  +NGSTF
Sbjct:    1 MPYFTIDTNKPQDSI-SSAFLKKAPNVVPKALGKPESYVSIHVNGGQPMVFGGSEDPCPVCVLKSIGCVGPKVNNSHAEKLYKLLADELKIPKNRCYIESVDIEASSMAFNGSTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIF_XENTR (Macrophage migration inhibitory factor OS=Xenopus tropicalis GN=mif PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.044e-15
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   + TNV  D +   ++LS+ T  +A   GKP  Y+ I +     MSFG + DP A   L SIG +    NK  S  +   L K++++P +R +I F+D   +N GWNGSTF
Sbjct:    1 MPTFTVCTNVCRDSMP-DTLLSDLTKLLAKATGKPAEYIAIHIMPDQMMSFGDSTDPCAVCSLSSIGKIGGPQNKSYSKLLCDYLTKQMNIPANRVYINFHDLNPANVGWNGSTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIF_CHICK (Macrophage migration inhibitory factor OS=Gallus gallus GN=MIF PE=3 SV=3)

HSP 1 Score: 83.1889 bits (204), Expect = 1.364e-15
Identity = 45/115 (39.13%), Postives = 60/115 (52.17%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   I TNV  D V   S+L E T  +A   GKP  Y+ + +     MSFGG+ DP A   L SIG +    NK  +  +  ++ K L V   R +I ++D   +N GWNGSTF
Sbjct:    1 MPMFTIHTNVCKDAVP-DSLLGELTQQLAKATGKPAQYIAVHIVPDQMMSFGGSTDPCALCSLYSIGKIGGQQNKTYTKLLCDMIAKHLHVSADRVYINYFDINAANVGWNGSTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIF_RAT (Macrophage migration inhibitory factor OS=Rattus norvegicus GN=Mif PE=1 SV=4)

HSP 1 Score: 78.1814 bits (191), Expect = 4.386e-14
Identity = 42/115 (36.52%), Postives = 58/115 (50.43%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   ++TNV    V     LSE T  +A   GKP  Y+ + +     M+F GT DP A   L SIG +    N+  S  +  +L  +L +   R +I +YD   +N GWNGSTF
Sbjct:    1 MPMFIVNTNVPRASVP-EGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTSDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIF_MOUSE (Macrophage migration inhibitory factor OS=Mus musculus GN=Mif PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 4.386e-14
Identity = 42/115 (36.52%), Postives = 58/115 (50.43%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   ++TNV    V     LSE T  +A   GKP  Y+ + +     M+F GT DP A   L SIG +    N+  S  +  +L  +L +   R +I +YD   +N GWNGSTF
Sbjct:    1 MPMFIVNTNVPRASVP-EGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTF 114          
BLAST of DN135037 vs. ExPASy Swiss-Prot
Match: MIF_MERUN (Macrophage migration inhibitory factor OS=Meriones unguiculatus GN=MIF PE=3 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 5.729e-14
Identity = 41/115 (35.65%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  102 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 446
            MP   ++TNV    V    +LSE T  +A   GKP  Y+ + +     M+F G+ DP A   L SIG +    N+  S  +  +L  +L +   R +I +YD   +N GWNGSTF
Sbjct:    1 MPMFIVNTNVPRSSVP-EGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGSSDPCALCSLHSIGKIGGAQNRTYSKLLCGLLADRLRISPDRIYINYYDMNAANVGWNGSTF 114          
The following BLAST results are available for this feature:
BLAST of DN135037 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
MIFH_TRISP1.078e-2042.61Macrophage migration inhibitory factor homolog OS=... [more]
MIFH_TRITR7.725e-1938.26Macrophage migration inhibitory factor homolog OS=... [more]
MIFH_BRUMA5.007e-1840.87Macrophage migration inhibitory factor homolog OS=... [more]
MIF_XENLA5.536e-1740.87Macrophage migration inhibitory factor OS=Xenopus ... [more]
MIFH_WUCBA1.233e-1640.00Macrophage migration inhibitory factor homolog OS=... [more]
MIF_XENTR1.044e-1538.26Macrophage migration inhibitory factor OS=Xenopus ... [more]
MIF_CHICK1.364e-1539.13Macrophage migration inhibitory factor OS=Gallus g... [more]
MIF_RAT4.386e-1436.52Macrophage migration inhibitory factor OS=Rattus n... [more]
MIF_MOUSE4.386e-1436.52Macrophage migration inhibitory factor OS=Mus musc... [more]
MIF_MERUN5.729e-1435.65Macrophage migration inhibitory factor OS=Meriones... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca05c07 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone wca05c07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135037 ID=DN135037|Name=DN135037|organism=Citrus sinensis|type=EST|length=672bp
GGGGACGACTATCAGTNNNNGAAAGAAAGAAAGAAAGAAAGAAAGAGAGT
GGTTAGGGGGAAGCTCCAAGAGTAGGGTTTTCCGTCGGAAGTTTCGAGAA
GATGCCTTGCTTGAACATTTCAACTAACGTCAAACTCGATGGCGTTGACA
CGTCATCCATCCTCTCCGAGGCCACCTCCACTGTCGCCAACATCATCGGC
AAACCCGAGGCCTACGTGATGATTGTGTTGAAGGGATCAGTACCTATGTC
TTTTGGTGGAACTGAGGACCCGGCAGCTTATGGTGAGTTGGTGTCCATTG
GTGGCCTTAACCCTGATGTGAACAAGAAGCTGAGTGCTGCAATTTCTGCA
ATTCTTGAAAAGAAGCTGTCGGTACCCAAGTCACGATTCTTCATCAAGTT
TTATGACACAAAGGGTTCAAACTTTGGATGGAATGGATCCACCTTCTAGA
TATTATTCTCAAAGCATGGCGCCATGAACTCTGACAATTGTCTTATCTAT
ATGGTGATTACAATCTTTAGAACAATGTTAATAATTGGCTGAATATTGTG
TAATTTCTCCTATGATGTGTTTTCTTCTCGTTGGTGCTAGCCAACAATAT
TGTGGAATAGGAACTGTTTGGTTTATGGAGTAATATTACATTTGCCAAAA
AAAAAAAAAAAAAAAANNAAAA
back to top