DN135029

Overview
NameDN135029
Unique NameDN135029
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length581
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:448..1027. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_ARATH (Ubiquitin-like protein 5 OS=Arabidopsis thaliana GN=UBL5 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.986e-35
Identity = 70/73 (95.89%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYS 276
            MIEVVLNDRLGKKVRVKCN+DDTIGDLKKLVAAQTGTRA+KIRIQKWYNIYKDHITLKDYEIHDGMGLELYY+
Sbjct:    1 MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYN 73          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_PSAOB (Ubiquitin-like protein 5 OS=Psammomys obesus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.801e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_MOUSE (Ubiquitin-like protein 5 OS=Mus musculus GN=Ubl5 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.801e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_MESAU (Ubiquitin-like protein 5 OS=Mesocricetus auratus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.801e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_HUMAN (Ubiquitin-like protein 5 OS=Homo sapiens GN=UBL5 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.801e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_BOVIN (Ubiquitin-like protein 5 OS=Bos taurus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.801e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_DANRE (Ubiquitin-like protein 5 OS=Danio rerio GN=ubl5 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.843e-28
Identity = 56/72 (77.78%), Postives = 66/72 (91.67%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN++DTIGDLKKL+AAQTGTR +KI ++KWY I+K+H++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNQEDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKNHVSLGDYEIHDGMNLELYY 72          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_CAEEL (Ubiquitin-like protein 5 OS=Caenorhabditis elegans GN=ubl-5 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.436e-27
Identity = 54/72 (75.00%), Postives = 62/72 (86.11%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIE+ +NDRLGKKVR+KCN  DTIGDLKKL+AAQTGTR +KI ++KWY IYKDHITL DYEIH+G   ELYY
Sbjct:    1 MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYY 72          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: UBL5_DROME (Ubiquitin-like protein 5 OS=Drosophila melanogaster GN=ubl PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 9.882e-27
Identity = 55/72 (76.39%), Postives = 62/72 (86.11%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIE+  NDRLGKKVRVKCN DDTIGDLKKL+AAQTGT+ +KI ++KWY I+KD I L DYEIHDGM LELYY
Sbjct:    1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYY 72          
BLAST of DN135029 vs. ExPASy Swiss-Prot
Match: HUB1_SCHPO (Ubiquitin-like modifier hub1 OS=Schizosaccharomyces pombe GN=hub1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 5.422e-25
Identity = 52/73 (71.23%), Postives = 63/73 (86.30%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYS 276
            MIEV+ NDRLGKKVRVKC  DDT+GD KKLVAAQTGT   +I ++KW++++KD+ITL DYEIHDGM LE+YYS
Sbjct:    1 MIEVLCNDRLGKKVRVKCMPDDTVGDFKKLVAAQTGTDPRRIVLKKWHSVFKDNITLADYEIHDGMSLEMYYS 73          
The following BLAST results are available for this feature:
BLAST of DN135029 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
UBL5_ARATH1.986e-3595.89Ubiquitin-like protein 5 OS=Arabidopsis thaliana G... [more]
UBL5_PSAOB1.801e-2880.56Ubiquitin-like protein 5 OS=Psammomys obesus GN=UB... [more]
UBL5_MOUSE1.801e-2880.56Ubiquitin-like protein 5 OS=Mus musculus GN=Ubl5 P... [more]
UBL5_MESAU1.801e-2880.56Ubiquitin-like protein 5 OS=Mesocricetus auratus G... [more]
UBL5_HUMAN1.801e-2880.56Ubiquitin-like protein 5 OS=Homo sapiens GN=UBL5 P... [more]
UBL5_BOVIN1.801e-2880.56Ubiquitin-like protein 5 OS=Bos taurus GN=UBL5 PE=... [more]
UBL5_DANRE6.843e-2877.78Ubiquitin-like protein 5 OS=Danio rerio GN=ubl5 PE... [more]
UBL5_CAEEL4.436e-2775.00Ubiquitin-like protein 5 OS=Caenorhabditis elegans... [more]
UBL5_DROME9.882e-2776.39Ubiquitin-like protein 5 OS=Drosophila melanogaste... [more]
HUB1_SCHPO5.422e-2571.23Ubiquitin-like modifier hub1 OS=Schizosaccharomyce... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca05b07 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone wca05b07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135029 ID=DN135029|Name=DN135029|organism=Citrus sinensis|type=EST|length=581bp
GGGGAAACGANNNANNNNNAAATCATTCGGCAGGGAAAATCAAAACAGGA
GACAAAGATGATTGAGGTGGTGCTGAACGACAGGCTCGGGAAGAAGGTGC
GCGTGAAGTGCAACGAAGACGACACCATAGGCGACTTGAAGAAGCTGGTG
GCGGCTCAGACCGGGACTCGAGCCGACAAGATTCGGATTCAGAAGTGGTA
CAACATCTACAAGGACCACATCACTCTCAAGGACTACGAGATTCACGACG
GCATGGGCCTTGAACTCTATTACAGCTAAATCCACCGTTAAATATATATG
CTGCTGCAAGCAGTCAATACTACTAGGAACCATATGCTATAATAAGCAAG
GGGTATTGGAAGATGCGGCAGGGCCAACTTTACTAATACTGTCTTGTAAG
AAAAAAATTTGTGAAGACTCGTAAAAACTTATTTGTGGTTATGTAACATA
TCTGGGATCTGGACTTACTCTCCATTTTGAATGGTGTTTAGATCTTTATC
AAGGTATTGAGGTACCACATGCTTGTCAGTCCATTAGGCTGATAGAATTT
TTTAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top