CX043514
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX043514 vs. ExPASy Swiss-Prot
Match: PGIP3_PHAVU (Polygalacturonase inhibitor 3 OS=Phaseolus vulgaris GN=PGIP3 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 8.070e-11 Identity = 33/65 (50.77%), Postives = 45/65 (69.23%), Query Frame = -2 Query: 607 LDFLDLSRNRFFGGIPSSLSQLRGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGNE-LCGLPLP 798 L+ LDL NR +G +P L+QL+ L +++S+NNL G+IP G LQ F+ S YA N+ LCG PLP Sbjct: 275 LNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP 339
BLAST of CX043514 vs. ExPASy Swiss-Prot
Match: PGIP2_PHAVU (Polygalacturonase inhibitor 2 OS=Phaseolus vulgaris GN=PGIP2 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 8.070e-11 Identity = 33/65 (50.77%), Postives = 45/65 (69.23%), Query Frame = -2 Query: 607 LDFLDLSRNRFFGGIPSSLSQLRGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGNE-LCGLPLP 798 L+ LDL NR +G +P L+QL+ L +++S+NNL G+IP G LQ F+ S YA N+ LCG PLP Sbjct: 275 LNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP 339 The following BLAST results are available for this feature:
BLAST of CX043514 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX043514 ID=CX043514; Name=CX043514; organism=Citrus sinensis; type=EST; length=799bpback to top |