DC887511
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DC887511 vs. ExPASy Swiss-Prot
Match: TPPC4_DICDI (Trafficking protein particle complex subunit 4 OS=Dictyostelium discoideum GN=trappc4 PE=3 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 6.917e-17 Identity = 37/59 (62.71%), Postives = 47/59 (79.66%), Query Frame = -3 Query: 244 CFQSLTGTKFFVVCEPGTQHMESLLKVIYELYTDYVLKNPFYEMEMPIRCELFDINLSQ 420 CFQ+ TG KF+V+ +P Q +E LL +YELYTDYVLKNPFYE+EM IRC+LFD L++ Sbjct: 71 CFQTHTGIKFYVIADPNHQQLEELLHGVYELYTDYVLKNPFYEIEMQIRCDLFDYKLNR 129
BLAST of DC887511 vs. ExPASy Swiss-Prot
Match: TPPC4_RAT (Trafficking protein particle complex subunit 4 OS=Rattus norvegicus GN=Trappc4 PE=2 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 1.541e-16 Identity = 37/62 (59.68%), Postives = 49/62 (79.03%), Query Frame = -3 Query: 235 CFQSLTGTKFFVVCEPGTQHMESLLKVIYELYTDYVLKNPFYEMEMPIRCELFDINLSQAVQ 420 CFQ+LTG KF V+ +P ++SLL+ IYE+Y+D+ LKNPFY +EMPIRCELFD NL A++ Sbjct: 146 CFQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALE 207
BLAST of DC887511 vs. ExPASy Swiss-Prot
Match: TPPC4_MOUSE (Trafficking protein particle complex subunit 4 OS=Mus musculus GN=Trappc4 PE=1 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 1.541e-16 Identity = 37/62 (59.68%), Postives = 49/62 (79.03%), Query Frame = -3 Query: 235 CFQSLTGTKFFVVCEPGTQHMESLLKVIYELYTDYVLKNPFYEMEMPIRCELFDINLSQAVQ 420 CFQ+LTG KF V+ +P ++SLL+ IYE+Y+D+ LKNPFY +EMPIRCELFD NL A++ Sbjct: 146 CFQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALE 207
BLAST of DC887511 vs. ExPASy Swiss-Prot
Match: TPPC4_BOVIN (Trafficking protein particle complex subunit 4 OS=Bos taurus GN=TRAPPC4 PE=2 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 1.541e-16 Identity = 37/62 (59.68%), Postives = 49/62 (79.03%), Query Frame = -3 Query: 235 CFQSLTGTKFFVVCEPGTQHMESLLKVIYELYTDYVLKNPFYEMEMPIRCELFDINLSQAVQ 420 CFQ+LTG KF V+ +P ++SLL+ IYE+Y+D+ LKNPFY +EMPIRCELFD NL A++ Sbjct: 146 CFQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALE 207
BLAST of DC887511 vs. ExPASy Swiss-Prot
Match: TPPC4_PONAB (Trafficking protein particle complex subunit 4 OS=Pongo abelii GN=TRAPPC4 PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 3.433e-16 Identity = 36/62 (58.06%), Postives = 49/62 (79.03%), Query Frame = -3 Query: 235 CFQSLTGTKFFVVCEPGTQHMESLLKVIYELYTDYVLKNPFYEMEMPIRCELFDINLSQAVQ 420 C+Q+LTG KF V+ +P ++SLL+ IYE+Y+D+ LKNPFY +EMPIRCELFD NL A++ Sbjct: 146 CYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALE 207
BLAST of DC887511 vs. ExPASy Swiss-Prot
Match: TPPC4_HUMAN (Trafficking protein particle complex subunit 4 OS=Homo sapiens GN=TRAPPC4 PE=1 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 3.433e-16 Identity = 36/62 (58.06%), Postives = 49/62 (79.03%), Query Frame = -3 Query: 235 CFQSLTGTKFFVVCEPGTQHMESLLKVIYELYTDYVLKNPFYEMEMPIRCELFDINLSQAVQ 420 C+Q+LTG KF V+ +P ++SLL+ IYE+Y+D+ LKNPFY +EMPIRCELFD NL A++ Sbjct: 146 CYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALE 207 The following BLAST results are available for this feature:
BLAST of DC887511 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DC887511 ID=DC887511; Name=DC887511; organism=Citrus sinensis; type=EST; length=422bpback to top |