CK939226
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 2.915e-15 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAMG 121 LTDPNPDDPLVPEIAHMYKTDR+KYETTARS TQKYAMG Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2) HSP 1 Score: 80.1073 bits (196), Expect = 3.807e-15 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAMG 121 LTDPNPDDPLVPEIAHMYKTDRSKYE+TARS TQKYAMG Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.481e-15 Identity = 36/39 (92.31%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAMG 121 LTDPNPDDPLVPEIAHMYKTDR+KYE+TARS TQKYAMG Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.889e-14 Identity = 35/39 (89.74%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAMG 121 LTDPNPDDPLVPEIAHMYKTD++KYE+TARS TQKYAMG Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.467e-14 Identity = 35/39 (89.74%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAMG 121 LTDPNPDDPLVPEIAHMYKTDR+KYE TAR+ TQKYAMG Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.209e-14 Identity = 34/39 (87.18%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAMG 121 LTDPNPDDPLVPEIAHMYKTD++KYE+TAR+ TQKYAMG Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.599e-13 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAMG 121 LTDPNPDDPLVPEIAH+YKTDR KYE+TA+S TQKYAMG Sbjct: 110 LTDPNPDDPLVPEIAHIYKTDRVKYESTAQSWTQKYAMG 148
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC12_ARATH (Probable ubiquitin-conjugating enzyme E2 12 OS=Arabidopsis thaliana GN=UBC12 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.309e-12 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAMG 121 LTDPNP+DPLVPEIAH+YK D+SKYE+TA+ TQKYAMG Sbjct: 111 LTDPNPNDPLVPEIAHLYKVDKSKYESTAQKWTQKYAMG 149
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAM 118 LTDPNPDDPLVPEIAH+YKTD++KYE ARS TQKYA+ Sbjct: 110 LTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYAL 147
BLAST of CK939226 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.497e-11 Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = 2 Query: 5 LTDPNPDDPLVPEIAHMYKTDRSKYETTARS*TQKYAM 118 LTDPNPDDPLVPEIAH+YKTDRS+YE +AR T+KYA+ Sbjct: 110 LTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147 The following BLAST results are available for this feature:
BLAST of CK939226 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK939226 ID=CK939226; Name=CK939226; organism=Citrus sinensis; type=EST; length=394bpback to top |