CK939220
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK939220 vs. ExPASy Swiss-Prot
Match: TOM7A_ARATH (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana GN=TOM7-1 PE=1 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 3.771e-17 Identity = 37/53 (69.81%), Postives = 46/53 (86.79%), Query Frame = 2 Query: 152 SEEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 310 S++KS D KEW+ W++KKAKVVTHYGFIPL+I +GMNSDPKP ++QLLSPV Sbjct: 23 SDDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQLLSPV 75
BLAST of CK939220 vs. ExPASy Swiss-Prot
Match: TOM7A_SOLTU (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum GN=TOM7-1 PE=3 SV=3) HSP 1 Score: 80.8777 bits (198), Expect = 4.610e-15 Identity = 35/43 (81.40%), Postives = 39/43 (90.70%), Query Frame = 2 Query: 182 KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 310 KEW TWT KKAKV+THYGFIPL+IIIGMNS+PKP + QLLSPV Sbjct: 30 KEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72
BLAST of CK939220 vs. ExPASy Swiss-Prot
Match: TOM7B_ARATH (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana GN=TOM7-2 PE=3 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 7.863e-15 Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 2 Query: 152 SEEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 310 S S FK+W+ W+++KAKV THYGFIPLIIIIGMNSDPKP ++ LLSPV Sbjct: 25 SSASSKYKVFKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPKPHLFHLLSPV 77 The following BLAST results are available for this feature:
BLAST of CK939220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK939220 ID=CK939220; Name=CK939220; organism=Citrus sinensis; type=EST; length=555bpback to top |