CK938763
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CK938763 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 3.352e-16 Identity = 36/56 (64.29%), Postives = 45/56 (80.36%), Query Frame = 1 Query: 4 ADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 171 AD++QCVKKGSSY AD +ET+ S ++ VVMD AAE +G CKCGP+C+C NCTCG Sbjct: 11 ADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64
BLAST of CK938763 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.656e-13 Identity = 32/56 (57.14%), Postives = 41/56 (73.21%), Query Frame = 1 Query: 7 DRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGS 174 D+SQCVKKG+SY D VET+ S+V V+V +AAE +G CKCG CAC +C CG+ Sbjct: 11 DKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65
BLAST of CK938763 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.835e-12 Identity = 35/55 (63.64%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 4 ADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 168 AD SQCVKKG+S D VETD S++ VV M V AAE+ G CKCG +C CVNCTC Sbjct: 11 ADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62
BLAST of CK938763 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.486e-11 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1 Query: 4 ADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 171 AD +QCVKKG+SY VET+ + TV V D AAE +G CKCG C+CV+CTCG Sbjct: 11 ADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65
BLAST of CK938763 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 4.241e-11 Identity = 31/55 (56.36%), Postives = 38/55 (69.09%), Query Frame = 1 Query: 4 ADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 168 +D SQC KKG S+ VET+ + TV+ MD AAE GNCKCGP+CACV+C C Sbjct: 11 SDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64 The following BLAST results are available for this feature:
BLAST of CK938763 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK938763 ID=CK938763; Name=CK938763; organism=Citrus sinensis; type=EST; length=458bpback to top |