CK936534
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_DRANE (Apocytochrome f OS=Draba nemorosa GN=petA PE=3 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 5.400e-15 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_CITSI (Apocytochrome f OS=Citrus sinensis GN=petA PE=3 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 5.400e-15 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_POPTR (Apocytochrome f OS=Populus trichocarpa GN=petA PE=3 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 7.053e-15 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_POPAL (Apocytochrome f OS=Populus alba GN=petA PE=3 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 7.053e-15 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_PLAOC (Apocytochrome f OS=Platanus occidentalis GN=petA PE=3 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 7.053e-15 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_PANGI (Apocytochrome f OS=Panax ginseng GN=petA PE=3 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 7.053e-15 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_OENPA (Apocytochrome f OS=Oenothera parviflora GN=petA PE=3 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 7.053e-15 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 277 VLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 318
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_OENGL (Apocytochrome f OS=Oenothera glazioviana GN=petA PE=3 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 7.053e-15 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 277 VLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 318
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_OENEH (Apocytochrome f OS=Oenothera elata subsp. hookeri GN=petA PE=1 SV=2) HSP 1 Score: 81.2629 bits (199), Expect = 7.053e-15 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 277 VLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 318
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_OENBI (Apocytochrome f OS=Oenothera biennis GN=petA PE=3 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 7.053e-15 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 277 VLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 318 The following BLAST results are available for this feature:
BLAST of CK936534 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 98
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK936534 ID=CK936534; Name=CK936534; organism=Citrus sinensis; type=EST; length=801bpback to top |