EL492524
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 110.153 bits (274), Expect = 3.413e-24 Identity = 48/55 (87.27%), Postives = 50/55 (90.91%), Query Frame = 3 Query: 18 EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 + FHWQATIMGP DSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNI + S Sbjct: 29 DMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGS 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2) HSP 1 Score: 108.227 bits (269), Expect = 1.297e-23 Identity = 45/55 (81.82%), Postives = 51/55 (92.73%), Query Frame = 3 Query: 18 EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 + FHWQATIMGPP+SPYAGGVFLVSIHFPPDYPFKPPKV+F+TKV+HPNI + S Sbjct: 29 DMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGS 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1) HSP 1 Score: 107.842 bits (268), Expect = 1.694e-23 Identity = 46/55 (83.64%), Postives = 50/55 (90.91%), Query Frame = 3 Query: 18 EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 + FHWQATIMGP DSPY+GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNI + S Sbjct: 29 DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGS 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1) HSP 1 Score: 107.457 bits (267), Expect = 2.212e-23 Identity = 45/55 (81.82%), Postives = 50/55 (90.91%), Query Frame = 3 Query: 18 EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 + FHWQATIMGP DSPY+GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPN+ + S Sbjct: 29 DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGS 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1) HSP 1 Score: 107.457 bits (267), Expect = 2.212e-23 Identity = 46/55 (83.64%), Postives = 50/55 (90.91%), Query Frame = 3 Query: 18 EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 + FHWQATIMGP +SPYAGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNI + S Sbjct: 29 DMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGS 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1) HSP 1 Score: 106.301 bits (264), Expect = 4.928e-23 Identity = 45/55 (81.82%), Postives = 50/55 (90.91%), Query Frame = 3 Query: 18 EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 + FHWQATIMGP +SPY+GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNI + S Sbjct: 29 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGS 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1) HSP 1 Score: 105.145 bits (261), Expect = 1.098e-22 Identity = 46/60 (76.67%), Postives = 51/60 (85.00%), Query Frame = 3 Query: 3 GGRG*EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 G G + F WQATIMGP DSP+AGGVFLV+IHFPPDYPFKPPKVAFRTKV+HPNI + S Sbjct: 24 GPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGS 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1) HSP 1 Score: 105.145 bits (261), Expect = 1.098e-22 Identity = 45/60 (75.00%), Postives = 51/60 (85.00%), Query Frame = 3 Query: 3 GGRG*EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 G G + FHWQATIMGP +SPY+GGVFLV+IHFPPDYPFKPPKV FRTKVFHPNI + + Sbjct: 24 GPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGN 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBCD1_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=1 SV=1) HSP 1 Score: 100.138 bits (248), Expect = 3.532e-21 Identity = 42/60 (70.00%), Postives = 49/60 (81.67%), Query Frame = 3 Query: 3 GGRG*EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 G G + FHWQATIMGPPDSPY GGVF ++IHFP DYPFKPPKVAF T+++HPNI + S Sbjct: 24 GPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGS 83
BLAST of EL492524 vs. ExPASy Swiss-Prot
Match: UBC2_CAEEL (Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans GN=let-70 PE=1 SV=1) HSP 1 Score: 98.5969 bits (244), Expect = 1.028e-20 Identity = 41/60 (68.33%), Postives = 49/60 (81.67%), Query Frame = 3 Query: 3 GGRG*EWFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNITQDSS 182 G G + FHWQATIMGPP+SPY GGVF ++IHFP DYPFKPPKVAF T+++HPNI + S Sbjct: 24 GPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGS 83 The following BLAST results are available for this feature:
BLAST of EL492524 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 54
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EL492524 ID=EL492524; Name=EL492524; organism=Citrus sinensis; type=EST; length=183bpback to top |