CV884936
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CV884936 vs. ExPASy Swiss-Prot
Match: LSM4_FAGSY (Probable U6 snRNA-associated Sm-like protein LSm4 OS=Fagus sylvatica GN=LSM4 PE=2 SV=1) HSP 1 Score: 107.457 bits (267), Expect = 9.069e-23 Identity = 48/50 (96.00%), Postives = 50/50 (100.00%), Query Frame = -3 Query: 643 VICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRSDRKPP 792 VICTSKDGDRFWRMP+CYIRGNTIKYLRVPDEVIDKVQEETKSR+DRKPP Sbjct: 43 VICTSKDGDRFWRMPDCYIRGNTIKYLRVPDEVIDKVQEETKSRADRKPP 92
BLAST of CV884936 vs. ExPASy Swiss-Prot
Match: LSM4_TOBAC (Probable U6 snRNA-associated Sm-like protein LSm4 OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 106.301 bits (264), Expect = 2.020e-22 Identity = 47/50 (94.00%), Postives = 49/50 (98.00%), Query Frame = -3 Query: 643 VICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRSDRKPP 792 VICTSKDGDRFWRMPECY+RGNTIKYLRVPDEVIDKVQEE KSR+DRKPP Sbjct: 43 VICTSKDGDRFWRMPECYVRGNTIKYLRVPDEVIDKVQEEAKSRTDRKPP 92
BLAST of CV884936 vs. ExPASy Swiss-Prot
Match: LSM4_ORYSJ (Probable U6 snRNA-associated Sm-like protein LSm4 OS=Oryza sativa subsp. japonica GN=Os01g0256900 PE=2 SV=1) HSP 1 Score: 102.834 bits (255), Expect = 2.234e-21 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = -3 Query: 643 VICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEET-KSRSDRKPP 792 VICTSKDGD+FWRMPECYIRGNTIKYLRVPDEVIDKVQEET KSRSDR+PP Sbjct: 43 VICTSKDGDKFWRMPECYIRGNTIKYLRVPDEVIDKVQEETSKSRSDRRPP 93
BLAST of CV884936 vs. ExPASy Swiss-Prot
Match: LSM4_MOUSE (U6 snRNA-associated Sm-like protein LSm4 OS=Mus musculus GN=Lsm4 PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 5.329e-15 Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = -3 Query: 643 VICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRSDRKPP 792 VICTS+DGD+FWRMPECYIRG+TIKYLR+PDE+ID V+EE R P Sbjct: 43 VICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREEAAKGRGRGGP 92
BLAST of CV884936 vs. ExPASy Swiss-Prot
Match: LSM4_HUMAN (U6 snRNA-associated Sm-like protein LSm4 OS=Homo sapiens GN=LSM4 PE=1 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 9.090e-15 Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -3 Query: 661 VICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSR 792 VICTS+DGD+FWRMPECYIRG+TIKYLR+PDE+ID V+EE ++ Sbjct: 43 VICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAK 86
BLAST of CV884936 vs. ExPASy Swiss-Prot
Match: LSM4_BOVIN (U6 snRNA-associated Sm-like protein LSm4 OS=Bos taurus GN=LSM4 PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 9.090e-15 Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -3 Query: 661 VICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSR 792 VICTS+DGD+FWRMPECYIRG+TIKYLR+PDE+ID V+EE ++ Sbjct: 43 VICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAK 86 The following BLAST results are available for this feature:
BLAST of CV884936 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CV884936 ID=CV884936; Name=CV884936; organism=Citrus sinensis; type=EST; length=794bpback to top |