CV884208

Overview
NameCV884208
Unique NameCV884208
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length902
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Library UCRCS04-UCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CV884208 vs. ExPASy Swiss-Prot
Match: ASPL1_ARATH (Aspartic proteinase-like protein 1 OS=Arabidopsis thaliana GN=At5g10080 PE=1 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 5.262e-81
Identity = 152/301 (50.50%), Postives = 196/301 (65.12%), Query Frame = 3
Query:    6 PKKNSVEYLELLLSNDWKRQNTRVKXXXXXXXXXXXXXFPSEGSQTHFFGNQFYWLHYTWIDIGTPNVSFLVALDAGSNLLWVPCQCIQCAPLSASYYTSL-DRNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPCPYIADYSTEDTSSSGYLVDDILHLASFSKHA---PQSSVQSSVIIGCGRKQTGSYLDGAAPDGVMGLGLGDVSVPSLLAKAGLIQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPI-GEKYDAYFVGVESYCIGNSCLTQSGFQALVDSGASFTFLPQK 893
            P K S+EY  LL  +D++RQ   +               PSEGS+T   GN F WLHYTWIDIGTP+VSFLVALD GSNLLW+PC C+QCAPL+++YY+SL  ++L                               + CPY  +Y + +TSSSG LV+DILHL   + +      SSV++ V+IGCG+KQ+G YLDG APDG+MGLG  ++SVPS L+KAGL++NSFS+CFDE DSG ++FGD GP+ QQST FL +   KY  Y VGVE+ CIGNSCL Q+ F   +DSG SFT+LP++
Sbjct:   51 PNKQSLEYYRLLAESDFRRQRMNL-------GAKVQSLVPSEGSKTISSGNDFGWLHYTWIDIGTPSVSFLVALDTGSNLLWIPCNCVQCAPLTSTYYSSLATKDLNEYNPSSSSTSKVFLCSHKLCDSASDCESPKEQCPYTVNYLSGNTSSSGLLVEDILHLTYNTNNRLMNGSSSVKARVVIGCGKKQSGDYLDGVAPDGLMGLGPAEISVPSFLSKAGLMRNSFSLCFDEEDSGRIYFGDMGPSIQQSTPFLQLDNNKYSGYIVGVEACCIGNSCLKQTSFTTFIDSGQSFTYLPEE 344          
The following BLAST results are available for this feature:
BLAST of CV884208 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
ASPL1_ARATH5.262e-8150.50Aspartic proteinase-like protein 1 OS=Arabidopsis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS04_2_002A03_T3 Ruby Orange Developing Flower cDNA Library UCRCS04-UCR Citrus sinensis cDNA clone UCRCS04_002_T3_A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV884208 ID=CV884208|Name=CV884208|organism=Citrus sinensis|type=EST|length=902bp
CGTGGCCGAAGAAGAACAGCGTCGAGTACCTGGAGCTGCTTTTGAGTAAC
GATTGGAAACGGCAAAACACGAGAGTGAAGTTACAGAGTAATAATAACTC
TTCGCGGAATCAATTGTTGTTTCCTTCTGAAGGAAGTCAAACTCATTTCT
TCGGAAATCAGTTTTACTGGTTACATTACACGTGGATTGATATTGGGACA
CCAAACGTTTCGTTTCTTGTAGCATTGGATGCTGGGAGCAATTTGCTTTG
GGTCCCATGCCAATGCATACAATGCGCTCCTTTGTCTGCCAGTTACTACA
CTTCTTTGGATAGAAATCTGAGTGAGTATGATCCATCTTCATCGAGCAGC
AGCAAGAATGTCTCTTGCAGTCATCACTTATGCAAGTCTCGTTCTAGCTG
CAAAAGTTTGAAGGATCCCTGTCCTTATATTGCAGATTATTCCACAGAAG
ATACCTCGAGTTCTGGTTATCTTGTTGACGACATTTTGCATTTGGCTTCT
TTCAGCAAACATGCACCCCAAAGTTCTGTGCAATCATCAGTCATTATAGG
CTGTGGAAGGAAGCAAACTGGCAGTTATTTGGATGGAGCAGCCCCTGATG
GTGTAATGGGATTGGGGCTTGGGGATGTTTCAGTACCAAGTTTGCTTGCG
AAAGCAGGATTAATACAAAATTCATTCTCTATTTGTTTCGATGAGAATGA
TTCAGGCAGTGTTTTCTTTGGAGACCAAGGGCCTGCAACCCAACAATCGA
CTTCATTCTTGCCTATTGGAGAAAAATATGACGCCTACTTCGTTGGGGTG
GAGTCTTACTGTATTGGAAATTCTTGTCTTACACAATCTGGATTCCAAGC
ACTAGTTGACAGTGGTGCATCTTTCACTTTTCTTCCACAGAAATTTATGC
TG
back to top