GO242338
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GO242338 vs. ExPASy Swiss-Prot
Match: TOM7A_ARATH (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana GN=TOM7-1 PE=1 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 4.105e-17 Identity = 36/52 (69.23%), Postives = 45/52 (86.54%), Query Frame = 3 Query: 3 EEKSMIDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 158 ++KS D KEW+ W++KKAKVVTHYGFIPL+I +GMNSDPKP ++QLLSPV Sbjct: 24 DDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQLLSPV 75
BLAST of GO242338 vs. ExPASy Swiss-Prot
Match: TOM7A_SOLTU (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum GN=TOM7-1 PE=3 SV=3) HSP 1 Score: 80.8777 bits (198), Expect = 2.252e-15 Identity = 35/43 (81.40%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 30 KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 158 KEW TWT KKAKV+THYGFIPL+IIIGMNS+PKP + QLLSPV Sbjct: 30 KEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72
BLAST of GO242338 vs. ExPASy Swiss-Prot
Match: TOM7B_ARATH (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana GN=TOM7-2 PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.553e-15 Identity = 33/44 (75.00%), Postives = 40/44 (90.91%), Query Frame = 3 Query: 27 FKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 158 FK+W+ W+++KAKV THYGFIPLIIIIGMNSDPKP ++ LLSPV Sbjct: 34 FKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPKPHLFHLLSPV 77 The following BLAST results are available for this feature:
BLAST of GO242338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
|