GO242082
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GO242082 vs. ExPASy Swiss-Prot
Match: BZR1_ARATH (Protein BRASSINAZOLE-RESISTANT 1 OS=Arabidopsis thaliana GN=BZR1 PE=1 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.831e-12 Identity = 32/42 (76.19%), Postives = 39/42 (92.86%), Query Frame = 1 Query: 64 ERGQVSEFEFESERVKPWEGERIHEVGVDDLELTLGSGKARG 189 E GQ SEF+FE+ +VKPWEGERIH+VG++DLELTLG+GKARG Sbjct: 295 EIGQSSEFKFENSQVKPWEGERIHDVGMEDLELTLGNGKARG 336
BLAST of GO242082 vs. ExPASy Swiss-Prot
Match: BEH2_ARATH (BES1/BZR1 homolog protein 2 OS=Arabidopsis thaliana GN=BEH2 PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.328e-12 Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 49 WGMAAERGQVSEFEFESERVKPWEGERIHEVGVDDLELTLGSGKAR 186 WGM+ G+ +EFEFE+ VKPWEGE IHEVGV+DLELTLG KAR Sbjct: 272 WGMSGMNGRGAEFEFENGTVKPWEGEMIHEVGVEDLELTLGGTKAR 317 The following BLAST results are available for this feature:
BLAST of GO242082 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
|