DT214571

Overview
NameDT214571
Unique NameDT214571
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length478
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13399 contig Csv1_Contig13399:75..552. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214571 vs. ExPASy Swiss-Prot
Match: Y615_SYNY3 (UPF0016 membrane protein sll0615 OS=Synechocystis sp. (strain PCC 6803) GN=sll0615 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.626e-14
Identity = 39/105 (37.14%), Postives = 60/105 (57.14%), Query Frame = -2
Query:  139 DEQKEAELAV*EFSGNXXXXXXXXXXXXXTFTLVFVDEWGDKSFFSTIALAAASSPLGVIGGALAGHVVATLLAVLGGSLLGTFLSEKAIAYIGGVLFLFFAAVT 453
            +E ++AE A+                   +F L FV EWGD++  +TIALAA+++  GV  GA+ GH +  ++AV+GG  +   +SEK +  IGG+LF  FA V+
Sbjct:   96 EEMEDAEKAIASGEKKLKIVPRGWGIVVESFALTFVAEWGDRTQIATIALAASNNAWGVSAGAILGHTICAVIAVMGGKFVAGRISEKTVTLIGGLLFYLFAVVS 200          
BLAST of DT214571 vs. ExPASy Swiss-Prot
Match: YD68_SCHPO (UPF0016 membrane protein C17G8.08c OS=Schizosaccharomyces pombe GN=SPAC17G8.08c PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.560e-12
Identity = 33/74 (44.59%), Postives = 45/74 (60.81%), Query Frame = -2
Query:  142 FTLVFVDEWGDKSFFSTIALAAASSPLGVIGGALAGHVVATLLAVLGGSLLGTFLSEKAIAYIGGVLFLFFAAV 363
            F L FV EWGD+S  +TIA+AA+ +  GV  GA  GH   T LAV+ G  + T +    + +IGG+LF+ F  V
Sbjct:  207 FALTFVSEWGDRSQIATIAMAASDNVYGVFMGANVGHACCTALAVISGKYISTKIKVHKVMFIGGILFIAFGLV 280          
BLAST of DT214571 vs. ExPASy Swiss-Prot
Match: TM165_RAT (Transmembrane protein 165 OS=Rattus norvegicus GN=Tmem165 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.560e-12
Identity = 33/71 (46.48%), Postives = 45/71 (63.38%), Query Frame = -2
Query:  148 TLVFVDEWGDKSFFSTIALAAASSPLGVIGGALAGHVVATLLAVLGGSLLGTFLSEKAIAYIGGVLFLFFA 360
            TL F+ EWGD+S  +TI LAA   P GV  G   GH + T LAV+GG ++   +S + +  IGG++FL FA
Sbjct:  241 TLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFA 311          
BLAST of DT214571 vs. ExPASy Swiss-Prot
Match: TM165_MOUSE (Transmembrane protein 165 OS=Mus musculus GN=Tmem165 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 7.560e-12
Identity = 33/71 (46.48%), Postives = 45/71 (63.38%), Query Frame = -2
Query:  148 TLVFVDEWGDKSFFSTIALAAASSPLGVIGGALAGHVVATLLAVLGGSLLGTFLSEKAIAYIGGVLFLFFA 360
            TL F+ EWGD+S  +TI LAA   P GV  G   GH + T LAV+GG ++   +S + +  IGG++FL FA
Sbjct:  241 TLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFA 311          
BLAST of DT214571 vs. ExPASy Swiss-Prot
Match: TM165_HUMAN (Transmembrane protein 165 OS=Homo sapiens GN=TMEM165 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.560e-12
Identity = 33/71 (46.48%), Postives = 45/71 (63.38%), Query Frame = -2
Query:  148 TLVFVDEWGDKSFFSTIALAAASSPLGVIGGALAGHVVATLLAVLGGSLLGTFLSEKAIAYIGGVLFLFFA 360
            TL F+ EWGD+S  +TI LAA   P GV  G   GH + T LAV+GG ++   +S + +  IGG++FL FA
Sbjct:  242 TLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFA 312          
The following BLAST results are available for this feature:
BLAST of DT214571 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
Y615_SYNY33.626e-1437.14UPF0016 membrane protein sll0615 OS=Synechocystis ... [more]
YD68_SCHPO7.560e-1244.59UPF0016 membrane protein C17G8.08c OS=Schizosaccha... [more]
TM165_RAT7.560e-1246.48Transmembrane protein 165 OS=Rattus norvegicus GN=... [more]
TM165_MOUSE7.560e-1246.48Transmembrane protein 165 OS=Mus musculus GN=Tmem1... [more]
TM165_HUMAN7.560e-1246.48Transmembrane protein 165 OS=Homo sapiens GN=TMEM1... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_3D09_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-3D09-H17-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214571 ID=DT214571|Name=DT214571|organism=Citrus sinensis|type=EST|length=478bp
CAATTAAAGAAGTATTAGTTACAAAAATAGGATATCCCTTTAAGGGCAGC
ATGTCAATGGAAGCAAATACAATTCCGACAACGTTACTGAAATTTACGAA
TTCTGATTATCCAATCTCTAACTCACTATCTCAATCACAGTCACAGCGGC
AAAGAAAAGAAAAAGAACACCTCCAATGTACGCAATTGCCTTCTCTGATA
AGAATGTCCCGAGTAAAGAGCCTCCCAACACAGCAAGCAAAGTTGCAACA
ACATGACCAGCCAGTGCTCCCCCAATGACTCCAAGAGGTGAAGAGGCTGC
TGCAAGTGCTATTGTGGAGAAAAATGATTTGTCACCCCACTCATCAACAA
AAACTAAGGTGAAAGTGCTGATGATAGTGCTAGCAGCAGCTATAATTCCA
GCACCATTTCCTGAAAATTCTCAAACAGCTAGCTCTGCCTCTTTTTGTTC
ATCCTCAGATTTTAGACCATCAGTGGAG
back to top