DT214525

Overview
NameDT214525
Unique NameDT214525
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4865 contig Csv1_Contig4865:672..1304. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214525 vs. ExPASy Swiss-Prot
Match: NUD12_ARATH (Nudix hydrolase 12, mitochondrial OS=Arabidopsis thaliana GN=NUDT12 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.102e-11
Identity = 28/58 (48.28%), Postives = 42/58 (72.41%), Query Frame = -1
Query:  460 LEIWPEQESHYRKWLNIQDAF*LCRYEWMREALEKFMKVMSEERKVEITEEIVEPLPK 633
            LE WPE+++  R+WL +++A  LCRYEWM+ ALE+F++VM +ER++   EE V    K
Sbjct:  130 LEDWPERKNRERRWLTVKEALELCRYEWMQRALEEFLRVMEDERRLRTEEETVHDSSK 187          
The following BLAST results are available for this feature:
BLAST of DT214525 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
NUD12_ARATH4.102e-1148.28Nudix hydrolase 12, mitochondrial OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_57B06_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-57B06-C12-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214525 ID=DT214525|Name=DT214525|organism=Citrus sinensis|type=EST|length=633bp
TTTATAATGTTTGTGCTTTCTATTTTTAATCTTGAAAGCACTGTACACTT
TATAGGGGTAATAAACAGATAATGTTTATCAACTACCACTCTCTTATATT
TGATAGCTAGTGATTCTATTTCACAGCACTTGTGGATTCAAATGCACATC
ATCTCAATCCCAAACAAAACATACCCTAAATCTTTGAAAGGCGAAGTACA
TAGAAACCGGTATTACACTTCACAATTTCTTGTTCCCAAAACTGGAAGGC
ATTACCAGACTCGAAGAATAACATCTAGAGCCTACTGCATACACTGTATA
ATCGCGACACGAGATCAATTATCATGTCAATGGTAACCTCTTGAGAATTT
GCCAATGGAATGGGATTATAGCGCTAATGCCGTGATGTTGGCTGCTTGTG
GTTGTTACACAGTAATTTGAAGATACTATTTGACATTCTGCTATAACATC
TGGTACTGGCTTGGGAAGAGGTTCCACTATTTCTTCTGTGATCTCTACTT
TTCGCTCCTCTGACATAACTTTCATAAACTTCTCCAATGCCTCACGCATC
CATTCATACCGGCACAGTTAAAAGGCATCTTGTATGTTTAACCATTTCCT
GTAGTGGCTTTCCTGCTCTGGCCAGATTTCAAG
back to top