DT214524

Overview
NameDT214524
Unique NameDT214524
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length887
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_DANRE (SUMO-activating enzyme subunit 1 OS=Danio rerio GN=sae1 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.678e-15
Identity = 50/133 (37.59%), Postives = 77/133 (57.89%), Query Frame = -1
Query:  369 LQEAISVPWRALPRKASKL-----YFALRVLEQFEEAEGRSPGEISIA-DLPAVLKLKKELCEANALNASHVTDSLLERLIIGTREFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVEDVSN 749
            L+EA+ V W     K+S       YF L+VL +F   +GR P   S A D   +L+++ ++ E   L++  + ++ +        E  PVCAVVGG+LGQE++KA+S +  P +NFFFFD + G GVV+  S+
Sbjct:  218 LKEALEVDWTTEKAKSSLKRIPADYFLLQVLLKFRTDKGRDPQPDSFAEDSQLLLQIRDDVLETMGLSSDLLPNTFVSYCF---SEMSPVCAVVGGVLGQEIVKALSQRDAPHRNFFFFDGLKGSGVVDYFSS 347          
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_RAT (SUMO-activating enzyme subunit 1 OS=Rattus norvegicus GN=Sae1 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.737e-15
Identity = 47/130 (36.15%), Postives = 76/130 (58.46%), Query Frame = -1
Query:  381 PLQEAISVPW-----RALPRKASKLYFALRVLEQFEEAEGRSPGEISIA-DLPAVLKLKKELCEANALNASHVTDSLLERLIIGTREFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVE 752
            P++EA++V W     +A  ++ +  YF L+VL +F   +GR P   S + D   +L+++ ++ ++  ++   + D  +        E  PVCAVVGGIL QE++KA+S +  P  NFFFFD M G G+VE
Sbjct:  218 PVKEALAVDWSGEKAQAALKRTAPDYFLLQVLLKFRTDKGRDPTSDSYSEDAELLLQIRNDVFDSLGVSPDLLPDDFVRYCF---SEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGSGIVE 344          
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_MOUSE (SUMO-activating enzyme subunit 1 OS=Mus musculus GN=Sae1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.881e-15
Identity = 47/130 (36.15%), Postives = 74/130 (56.92%), Query Frame = -1
Query:  381 PLQEAISVPW-----RALPRKASKLYFALRVLEQFEEAEGRSPGEISIA-DLPAVLKLKKELCEANALNASHVTDSLLERLIIGTREFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVE 752
            P++EA+ V W     +A  ++ +  YF L+VL +F   +GR P   S   D   +L+++ ++ ++  ++   + D  +        E  PVCAVVGGIL QE++KA+S +  P  NFFFFD M G G+VE
Sbjct:  219 PVKEALEVDWSGEKAKAALKRTAPDYFLLQVLLKFRTDKGRDPTSESYKEDAELLLQIRNDVFDSLGISPDLLPDDFVRYCF---SEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGSGIVE 345          
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_PONAB (SUMO-activating enzyme subunit 1 OS=Pongo abelii GN=SAE1 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 1.087e-14
Identity = 46/133 (34.59%), Postives = 75/133 (56.39%), Query Frame = -1
Query:  381 VLHPLQEAISVPW-----RALPRKASKLYFALRVLEQFEEAEGRSPGEISIA-DLPAVLKLKKELCEANALNASHVTDSLLERLIIGTREFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVE 761
            V  P++EA+ V W     +A  ++ +  YF L+VL +F   +GR P   +   D   +L+++ ++ ++  ++   + +  +        E  PVCAVVGGIL QE++KA+S +  P  NFFFFD M G G+VE
Sbjct:  212 VFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCF---SEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVE 341          
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_HUMAN (SUMO-activating enzyme subunit 1 OS=Homo sapiens GN=SAE1 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.087e-14
Identity = 46/133 (34.59%), Postives = 75/133 (56.39%), Query Frame = -1
Query:  381 VLHPLQEAISVPW-----RALPRKASKLYFALRVLEQFEEAEGRSPGEISIA-DLPAVLKLKKELCEANALNASHVTDSLLERLIIGTREFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVE 761
            V  P++EA+ V W     +A  ++ +  YF L+VL +F   +GR P   +   D   +L+++ ++ ++  ++   + +  +        E  PVCAVVGGIL QE++KA+S +  P  NFFFFD M G G+VE
Sbjct:  212 VFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCF---SEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVE 341          
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_BOVIN (SUMO-activating enzyme subunit 1 OS=Bos taurus GN=SAE1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.087e-14
Identity = 46/129 (35.66%), Postives = 73/129 (56.59%), Query Frame = -1
Query:  381 LQEAISVPW-----RALPRKASKLYFALRVLEQFEEAEGRSPGEISIA-DLPAVLKLKKELCEANALNASHVTDSLLERLIIGTREFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVE 749
            ++EA+ V W     +A  ++ +  YF L+VL +F   +GR P   +   D   +L+++ ++ +A  +N   + +  +        E  PVCAVVGGIL QE++KA+S +  P  NFFFFD M G G+VE
Sbjct:  216 VKEALEVDWSSDKAKAALKRTTPDYFLLQVLLKFRTDKGRDPSSDTFGEDSELLLQIRNDVLDALGVNPDLLPEDFVRYCF---SEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVE 341          
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_XENLA (SUMO-activating enzyme subunit 1 OS=Xenopus laevis GN=sae1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.051e-13
Identity = 47/131 (35.88%), Postives = 74/131 (56.49%), Query Frame = -1
Query:  381 PLQEAISVPWRALPRKASKL-----YFALRVLEQFEEAEGRSPGEISIADLPAVLKLKKELCEANALNASHVTDSLLERLIIGT--REFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVE 752
            PL++A+ + WR+   K++       YF L+VL +F   +GR P   S  +   +L    ++C ++ L++  V+  LL +        E  PVCAVVGG+LGQE++KA+S +  P  NFFFFD     G+V+
Sbjct:  213 PLKDALEIDWRSEKAKSALKKTPTDYFLLQVLMKFRTDKGRDPQPSSYQEDSELLL---QIC-SDVLDSLGVSPDLLPKDFASYCFSEMAPVCAVVGGVLGQEIVKALSLRDAPHNNFFFFDGKTSNGIVD 339          
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_DICDI (SUMO-activating enzyme subunit 1 OS=Dictyostelium discoideum GN=sae1 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.736e-12
Identity = 46/133 (34.59%), Postives = 67/133 (50.38%), Query Frame = -1
Query:  381 VLHPLQEAISVPWRALPRKASKLYFALRVLEQFEEAEGRSPGEISIADLPAVLKL------KKELCEANALNASHVTDSLLERLIIGTREFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVE 761
            +    +E++   W     +    +FAL  L QFEE   R P  IS +DL  +  +      K  L   ++      T  LL ++ I   E  PVCA+VGGI+G E+IK I+   + L NFFF+D + G G+VE
Sbjct:  199 IFKSFKESMGYDWSKTNSRTPLPFFALSTLYQFEEKHNRVPDNISDSDLSELKSIINSSIEKFNLKNTDSNKYFEETKDLLNKMNI---EISPVCAIVGGIVGAEIIKIITQNMQVLNNFFFYDGVKGTGLVE 328          
BLAST of DT214524 vs. ExPASy Swiss-Prot
Match: SAE1_XENTR (SUMO-activating enzyme subunit 1 OS=Xenopus tropicalis GN=sae1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.276e-11
Identity = 43/131 (32.82%), Postives = 72/131 (54.96%), Query Frame = -1
Query:  381 PLQEAISVPW-----RALPRKASKLYFALRVLEQFEEAEGRSPGEISIADLPAVLKLKKELCEANALNASHVTDSLLERLIIGT--REFPPVCAVVGGILGQEVIKAISCKGEPLKNFFFFDVMDGKGVVE 752
            PL++A+ + W     ++  +K    +F L+VL +F   + R P   +  +   +L    ++C ++ L++  V+  LL +        E  PVCAVVGG+LGQE++KA+S +  P  NFFFFD     G+V+
Sbjct:  216 PLKDALEIDWHSEKAKSALKKTPTDFFLLQVLMKFRTDKKRDPQPSNYQEDSELLL---QIC-SDVLDSLGVSPDLLPKDFASYCFSEMAPVCAVVGGVLGQEIVKALSQRDAPHNNFFFFDGRSSNGIVD 342          
The following BLAST results are available for this feature:
BLAST of DT214524 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
SAE1_DANRE1.678e-1537.59SUMO-activating enzyme subunit 1 OS=Danio rerio GN... [more]
SAE1_RAT3.737e-1536.15SUMO-activating enzyme subunit 1 OS=Rattus norvegi... [more]
SAE1_MOUSE4.881e-1536.15SUMO-activating enzyme subunit 1 OS=Mus musculus G... [more]
SAE1_PONAB1.087e-1434.59SUMO-activating enzyme subunit 1 OS=Pongo abelii G... [more]
SAE1_HUMAN1.087e-1434.59SUMO-activating enzyme subunit 1 OS=Homo sapiens G... [more]
SAE1_BOVIN1.087e-1435.66SUMO-activating enzyme subunit 1 OS=Bos taurus GN=... [more]
SAE1_XENLA2.051e-1335.88SUMO-activating enzyme subunit 1 OS=Xenopus laevis... [more]
SAE1_DICDI1.736e-1234.59SUMO-activating enzyme subunit 1 OS=Dictyostelium ... [more]
SAE1_XENTR4.276e-1132.82SUMO-activating enzyme subunit 1 OS=Xenopus tropic... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_54D11_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-54D11-G22-1-4.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214524 ID=DT214524|Name=DT214524|organism=Citrus sinensis|type=EST|length=887bp
TTGCAGAGTAGCATTAATCAGGAAGTGCCACATGTCCTACATAGAAAAAG
ATCATTGTGAAAAGTTGGGAGGATACTTAAACGGTTAAATAAGCAACAAA
TAATTAACTTCATTCGTCCACACACTTTAGCAATAGAGATGGCAACAAAA
AAAAGGACACCCACTGAAGAAGTGCAGAGAGATTTCTGTCTTACCAACCT
AGAATTTTATATATAAAGTTAGTCGGCCAATCCTAGAAAGTTAGTCGACC
AATCCTAGAATACATCACCAGATTCTCAAATCTGCCATATTTACCAGATG
CCCATTAATTAACTTTGTTAATCAAAATGTTTTCGCCCAAGCAGCAGCTA
CTTAGATTCCTTTTTCGGGTTCGATACATCTTCTACTACGCCTTTCCCAT
CCATAACGTCAAAGAAGAAAAAGTTCTTCAGGGGTTCCCCCTTGCATGAT
ATTGCTTTAATAACCTCCTGCCCTAAAATTCCTCCAACAACGGCACAAAC
AGGAGGAAATTCTCTGGTACCGATGATCAATCTTTCTAGGAGGGAATCGG
TTACATGGGATGCATTGAGTGCATTTGCTTCACAAAGTTCTTTTTTCAGC
TTTAGAACCGCTGGAAGATCCGCAATCGAAATTTCACCTGGACTACGCCC
TTCAGCCTCCTCAAACTGTTCTAGAACTCTCAAAGCAAAATAAAGCTTAG
ATGCTTTCCTAGGAAGAGCTCTCCAAGGCACAGAAATTGCTTCCTGCAAA
GGATGAAGCACTTATAAGTCATCAATCAACCGCAAATGTACAGTTGATTT
TTACGCTCTAAAGAATTCAAAAATCATTCAAGCAATTCTTTTGGAAGGAC
ATTGCACTTGCAAGTCAATTATTGTAACAATCATTTG
back to top