DR912046
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR912046 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.627e-15 Identity = 34/53 (64.15%), Postives = 42/53 (79.25%), Query Frame = 2 Query: 2 SQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 160 +QCVKKGSSY AD +ET+ S ++ VVMD AAE +G CKCGP+C+C NCTCG Sbjct: 14 TQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64
BLAST of DR912046 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.805e-12 Identity = 31/54 (57.41%), Postives = 39/54 (72.22%), Query Frame = 2 Query: 2 SQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGS 163 SQCVKKG+SY D VET+ S+V V+V +AAE +G CKCG CAC +C CG+ Sbjct: 13 SQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65
BLAST of DR912046 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.404e-11 Identity = 33/52 (63.46%), Postives = 38/52 (73.08%), Query Frame = 2 Query: 2 SQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 157 SQCVKKG+S D VETD S++ VV M V AAE+ G CKCG +C CVNCTC Sbjct: 14 SQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62 The following BLAST results are available for this feature:
BLAST of DR912046 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DR912046 ID=DR912046; Name=DR912046; organism=Citrus sinensis; type=EST; length=194bpback to top |