DR912034
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR912034 vs. ExPASy Swiss-Prot
Match: CML13_ARATH (Probable calcium-binding protein CML13 OS=Arabidopsis thaliana GN=CML13 PE=1 SV=1) HSP 1 Score: 85.5001 bits (210), Expect = 9.218e-17 Identity = 42/43 (97.67%), Postives = 42/43 (97.67%), Query Frame = 2 Query: 65 LSDDQVSSMKEAFTLFDTDGDGKIAPSELGILMRSLGGNPTQA 193 LSDDQVSSMKEAF LFDTDGDGKIAPSELGILMRSLGGNPTQA Sbjct: 6 LSDDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTQA 48
BLAST of DR912034 vs. ExPASy Swiss-Prot
Match: CML14_ARATH (Probable calcium-binding protein CML14 OS=Arabidopsis thaliana GN=CML14 PE=2 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 1.738e-15 Identity = 39/43 (90.70%), Postives = 42/43 (97.67%), Query Frame = 2 Query: 65 LSDDQVSSMKEAFTLFDTDGDGKIAPSELGILMRSLGGNPTQA 193 LS+DQVSSMKEAF LFDTDGDGKIAPSELGILMRSLGGNPT++ Sbjct: 6 LSNDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTES 48
BLAST of DR912034 vs. ExPASy Swiss-Prot
Match: CML7_ORYSJ (Probable calcium-binding protein CML7 OS=Oryza sativa subsp. japonica GN=CML7 PE=2 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 3.873e-15 Identity = 36/44 (81.82%), Postives = 44/44 (100.00%), Query Frame = 2 Query: 62 DLSDDQVSSMKEAFTLFDTDGDGKIAPSELGILMRSLGGNPTQA 193 +LS++QV+SM+EAF+LFDTDGDG+IAPSELG+LMRSLGGNPTQA Sbjct: 5 ELSEEQVASMREAFSLFDTDGDGRIAPSELGVLMRSLGGNPTQA 48 The following BLAST results are available for this feature:
BLAST of DR912034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DR912034 ID=DR912034; Name=DR912034; organism=Citrus sinensis; type=EST; length=196bpback to top |