CX289348
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX289348 vs. ExPASy Swiss-Prot
Match: XYP11_ARATH (Xylogen-like protein 11 OS=Arabidopsis thaliana GN=XYP11 PE=1 SV=2) HSP 1 Score: 83.5741 bits (205), Expect = 3.499e-16 Identity = 38/78 (48.72%), Postives = 52/78 (66.67%), Query Frame = 2 Query: 2 DCLSYVTEGSNVTVPDKPCCPELAGLVESNPICLCQLL--GKNNTYGIKIDITRALKLPSVCGVTTPPVNLCSLAGVP 229 DC SYV GSN P+ CCPELAG+V+S+P C+C L G + +G+K+D RA +L ++CGV P +LCS+ G P Sbjct: 49 DCFSYVQVGSNEIKPEAACCPELAGMVQSSPECVCNLYGGGASPRFGVKLDKQRAEQLSTICGVKAPSPSLCSVLGFP 126
BLAST of CX289348 vs. ExPASy Swiss-Prot
Match: NLTL2_ARATH (Non-specific lipid-transfer protein-like protein At2g13820 OS=Arabidopsis thaliana GN=At2g13820 PE=1 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 8.067e-13 Identity = 31/73 (42.47%), Postives = 44/73 (60.27%), Query Frame = 2 Query: 2 DCLSYVTEGSNVTVPDKPCCPELAGLVESNPICLCQLLGKNNTYGIKIDITRALKLPSVCGVTTPPVNLCSLA 220 DCLS+VT GS V P+ CC L +V + P CLC+ + + G+ +D+++A LPSVC V PP C L+ Sbjct: 36 DCLSFVTSGSTVVKPEGTCCSGLKTVVRTGPECLCEAFKNSGSLGLTLDLSKAASLPSVCKVAAPPSARCGLS 108 The following BLAST results are available for this feature:
BLAST of CX289348 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX289348 ID=CX289348; Name=CX289348; organism=Citrus clementina; type=EST; length=357bpback to top |