CX289722
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX289722 vs. ExPASy Swiss-Prot
Match: YRDC_HUMAN (YrdC domain-containing protein, mitochondrial OS=Homo sapiens GN=YRDC PE=1 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 5.508e-12 Identity = 33/76 (43.42%), Postives = 52/76 (68.42%), Query Frame = 3 Query: 426 SSNLEKSLNPGLESIGVRVPDSNFVRVIARGLESALALTSANLTGQPSSVSVKDFENLWERCACVYDGGVLPSGRA 653 S L K LNP +G+R+PD F++ +A+ E LALTSANL+ Q SS++V++F++LW + + V DGG + G++ Sbjct: 156 SEELNKDLNPFTPLVGIRIPDHAFMQDLAQMFEGPLALTSANLSSQASSLNVEEFQDLWPQLSLVIDGGQIGDGQS 231
BLAST of CX289722 vs. ExPASy Swiss-Prot
Match: YRDC_BOVIN (YrdC domain-containing protein, mitochondrial OS=Bos taurus GN=YRDC PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.090e-11 Identity = 31/76 (40.79%), Postives = 50/76 (65.79%), Query Frame = 3 Query: 426 SSNLEKSLNPGLESIGVRVPDSNFVRVIARGLESALALTSANLTGQPSSVSVKDFENLWERCACVYDGGVLPSGRA 653 S L K LNP +G+R+PD F++ +A+ LALTSANL+ Q SS++V++F++LW + + DGG + G++ Sbjct: 154 SEELNKDLNPFTPLVGIRIPDHAFMQDLAQMFGGPLALTSANLSSQSSSLNVEEFQDLWPHLSLIIDGGPIGDGQS 229 The following BLAST results are available for this feature:
BLAST of CX289722 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX289722 ID=CX289722; Name=CX289722; organism=Citrus clementina; type=EST; length=680bpback to top |