CX294889
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX294889 vs. ExPASy Swiss-Prot
Match: U2A2B_ARATH (Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 3.008e-12 Identity = 32/49 (65.31%), Postives = 37/49 (75.51%), Query Frame = 3 Query: 27 TPGVGKVFLEYYDAVGCATAKNALSGRKFGGNTVNAFYYPEDKYFNKDY 173 TPGVGKVFLEY D G + A++ ++GRKFGGN V A YYPEDKY DY Sbjct: 539 TPGVGKVFLEYADVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDY 587
BLAST of CX294889 vs. ExPASy Swiss-Prot
Match: U2A2A_NICPL (Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.673e-11 Identity = 30/51 (58.82%), Postives = 37/51 (72.55%), Query Frame = 3 Query: 27 TPGVGKVFLEYYDAVGCATAKNALSGRKFGGNTVNAFYYPEDKYFNKDYSA 179 TPG+GKVFLEY D G + A+ L+GRKFGGN V A +YPE+K+ DY A Sbjct: 505 TPGLGKVFLEYADVDGSSKARQGLNGRKFGGNQVVAVFYPENKFSEGDYEA 555
BLAST of CX294889 vs. ExPASy Swiss-Prot
Match: U2A2B_NICPL (Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.409e-11 Identity = 29/49 (59.18%), Postives = 37/49 (75.51%), Query Frame = 3 Query: 27 TPGVGKVFLEYYDAVGCATAKNALSGRKFGGNTVNAFYYPEDKYFNKDY 173 TPGVGKVFLEY D + A+ +L+GRKFGGN V A +YPE+K++ DY Sbjct: 523 TPGVGKVFLEYADVDSSSKARQSLNGRKFGGNQVVAVFYPENKFYEGDY 571 The following BLAST results are available for this feature:
BLAST of CX294889 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX294889 ID=CX294889; Name=CX294889; organism=Citrus clementina; type=EST; length=372bpback to top |