CX297709
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX297709 vs. ExPASy Swiss-Prot
Match: ILV5_ARATH (Ketol-acid reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=At3g58610 PE=2 SV=2) HSP 1 Score: 83.9593 bits (206), Expect = 2.667e-16 Identity = 40/43 (93.02%), Postives = 40/43 (93.02%), Query Frame = 3 Query: 6 ISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGSN 134 ISNF SDPVHGAIEVCAQLRPTVDISVP DADFVRPELRQ SN Sbjct: 549 ISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591
BLAST of CX297709 vs. ExPASy Swiss-Prot
Match: ILV5_ORYSJ (Ketol-acid reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0573700 PE=1 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.570e-15 Identity = 37/42 (88.10%), Postives = 40/42 (95.24%), Query Frame = 3 Query: 6 ISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGS 131 ISNF+SDPVHGAIEVCA+LRPTVDISVP +ADFVRPELRQ S Sbjct: 537 ISNFMSDPVHGAIEVCAELRPTVDISVPANADFVRPELRQSS 578
BLAST of CX297709 vs. ExPASy Swiss-Prot
Match: ILV5_PEA (Ketol-acid reductoisomerase, chloroplastic OS=Pisum sativum GN=PGAAIR PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.258e-14 Identity = 36/43 (83.72%), Postives = 40/43 (93.02%), Query Frame = 3 Query: 6 ISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGSN 134 ISNF+SDPVHGAI+VCA+LRPT+DISVP ADFVRPELRQ SN Sbjct: 539 ISNFVSDPVHGAIQVCAELRPTLDISVPAAADFVRPELRQCSN 581
BLAST of CX297709 vs. ExPASy Swiss-Prot
Match: ILV5_SPIOL (Ketol-acid reductoisomerase, chloroplastic OS=Spinacia oleracea GN=AHRI PE=1 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.789e-12 Identity = 35/40 (87.50%), Postives = 36/40 (90.00%), Query Frame = 3 Query: 6 ISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQ 125 ISNFLSDPVH AI VCAQLRP+VDISV DADFVRPELRQ Sbjct: 555 ISNFLSDPVHEAIGVCAQLRPSVDISVTADADFVRPELRQ 594 The following BLAST results are available for this feature:
BLAST of CX297709 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX297709 ID=CX297709; Name=CX297709; organism=Citrus clementina; type=EST; length=388bpback to top |