CX297919
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX297919 vs. ExPASy Swiss-Prot
Match: TLP1_PYRPY (Thaumatin-like protein 1 OS=Pyrus pyrifolia GN=TL1 PE=1 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 3.408e-16 Identity = 33/42 (78.57%), Postives = 40/42 (95.24%), Query Frame = 3 Query: 3 PPTKYSKIFKDQCPQAYSYAYDDRTSTFSCTGGPNYDITFCP 128 PPT +SK+FK+QCPQAYSYAYDD++STF+C GGPNY+ITFCP Sbjct: 203 PPTDFSKVFKNQCPQAYSYAYDDKSSTFTCFGGPNYEITFCP 244
BLAST of CX297919 vs. ExPASy Swiss-Prot
Match: TP1B_MALDO (Thaumatin-like protein 1b (Fragment) OS=Malus domestica PE=2 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 6.428e-15 Identity = 32/42 (76.19%), Postives = 39/42 (92.86%), Query Frame = 3 Query: 3 PPTKYSKIFKDQCPQAYSYAYDDRTSTFSCTGGPNYDITFCP 128 PPT+YS+IF+ QCPQAYSYAYDD+ STF+C+GGP+Y ITFCP Sbjct: 171 PPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 212
BLAST of CX297919 vs. ExPASy Swiss-Prot
Match: TP1A_MALDO (Thaumatin-like protein 1a OS=Malus domestica GN=TL1 PE=1 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 6.428e-15 Identity = 32/42 (76.19%), Postives = 39/42 (92.86%), Query Frame = 3 Query: 3 PPTKYSKIFKDQCPQAYSYAYDDRTSTFSCTGGPNYDITFCP 128 PPT+YS+IF+ QCPQAYSYAYDD+ STF+C+GGP+Y ITFCP Sbjct: 205 PPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 246
BLAST of CX297919 vs. ExPASy Swiss-Prot
Match: TLP1_CASSA (Thaumatin-like protein 1 OS=Castanea sativa GN=TL1 PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 1.096e-14 Identity = 33/42 (78.57%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 3 PPTKYSKIFKDQCPQAYSYAYDDRTSTFSCTGGPNYDITFCP 128 P TKYS+IFK QCPQAYSYAYDD TSTF+C+G P+Y ITFCP Sbjct: 202 PATKYSRIFKQQCPQAYSYAYDDSTSTFTCSGAPDYVITFCP 243
BLAST of CX297919 vs. ExPASy Swiss-Prot
Match: TLP_PRUAV (Glucan endo-1,3-beta-glucosidase OS=Prunus avium PE=1 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.583e-13 Identity = 30/42 (71.43%), Postives = 34/42 (80.95%), Query Frame = 3 Query: 3 PPTKYSKIFKDQCPQAYSYAYDDRTSTFSCTGGPNYDITFCP 128 PPT YS+IF + CP AYSYAYDD+ TF+C GGPNY ITFCP Sbjct: 204 PPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGGPNYAITFCP 245
BLAST of CX297919 vs. ExPASy Swiss-Prot
Match: TLP1_PRUPE (Thaumatin-like protein 1 OS=Prunus persica PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 2.068e-13 Identity = 31/42 (73.81%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 3 PPTKYSKIFKDQCPQAYSYAYDDRTSTFSCTGGPNYDITFCP 128 PP YSK+FK QCPQAYSYAYDD++STF+C+G P Y ITFCP Sbjct: 205 PPPDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPAYLITFCP 246
BLAST of CX297919 vs. ExPASy Swiss-Prot
Match: PR5_ARATH (Pathogenesis-related protein 5 OS=Arabidopsis thaliana GN=At1g75040 PE=1 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 2.701e-13 Identity = 32/42 (76.19%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 3 PPTKYSKIFKDQCPQAYSYAYDDRTSTFSCTGGPNYDITFCP 128 PPT YS+IFK+ CP AYSYAYDD TSTF+CTG NY+ITFCP Sbjct: 199 PPTDYSRIFKNACPDAYSYAYDDETSTFTCTGA-NYEITFCP 239
BLAST of CX297919 vs. ExPASy Swiss-Prot
Match: TLP2_PRUPE (Thaumatin-like protein 2 OS=Prunus persica PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 7.858e-13 Identity = 29/42 (69.05%), Postives = 34/42 (80.95%), Query Frame = 3 Query: 3 PPTKYSKIFKDQCPQAYSYAYDDRTSTFSCTGGPNYDITFCP 128 PPT YS+IF +QCP AYSYA+DD F+C+GGPNY ITFCP Sbjct: 201 PPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242 The following BLAST results are available for this feature:
BLAST of CX297919 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 8
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX297919 ID=CX297919; Name=CX297919; organism=Citrus clementina; type=EST; length=508bpback to top |