CX298550
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX298550 vs. ExPASy Swiss-Prot
Match: PTI5_SOLLC (Pathogenesis-related genes transcriptional activator PTI5 OS=Solanum lycopersicum GN=PTI5 PE=2 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 5.370e-15 Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 2 Query: 386 RDSARHGQRIWLGTFETAKEAALAYDRAAFRMRGAKALLNF 508 RDSARHG R+WLGTFETA+EAALAYDRAAFRMRGAKALLNF Sbjct: 75 RDSARHGARVWLGTFETAEEAALAYDRAAFRMRGAKALLNF 115
BLAST of CX298550 vs. ExPASy Swiss-Prot
Match: EF100_ARATH (Ethylene-responsive transcription factor 1A OS=Arabidopsis thaliana GN=ERF1A PE=1 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 3.258e-12 Identity = 32/41 (78.05%), Postives = 39/41 (95.12%), Query Frame = 2 Query: 386 RDSARHGQRIWLGTFETAKEAALAYDRAAFRMRGAKALLNF 508 RD A++G R+WLGTFETA++AALAYDRAAFRMRG++ALLNF Sbjct: 164 RDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNF 204
BLAST of CX298550 vs. ExPASy Swiss-Prot
Match: ERF2_TOBAC (Ethylene-responsive transcription factor 2 OS=Nicotiana tabacum GN=ERF2 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.257e-12 Identity = 31/41 (75.61%), Postives = 39/41 (95.12%), Query Frame = 2 Query: 386 RDSARHGQRIWLGTFETAKEAALAYDRAAFRMRGAKALLNF 508 RD A++G R+WLGT+ETA+EAALAYD+AA+RMRG+KALLNF Sbjct: 115 RDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNF 155
BLAST of CX298550 vs. ExPASy Swiss-Prot
Match: ERF2_NICSY (Ethylene-responsive transcription factor 2 OS=Nicotiana sylvestris GN=ERF2 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.257e-12 Identity = 31/41 (75.61%), Postives = 39/41 (95.12%), Query Frame = 2 Query: 386 RDSARHGQRIWLGTFETAKEAALAYDRAAFRMRGAKALLNF 508 RD A++G R+WLGT+ETA+EAALAYD+AA+RMRG+KALLNF Sbjct: 119 RDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNF 159
BLAST of CX298550 vs. ExPASy Swiss-Prot
Match: ERF95_ARATH (Ethylene-responsive transcription factor ERF095 OS=Arabidopsis thaliana GN=ERF095 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.112e-11 Identity = 31/41 (75.61%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 386 RDSARHGQRIWLGTFETAKEAALAYDRAAFRMRGAKALLNF 508 RDSARHG R+WLGTF TA++AA AYDRAAF MRG +A+LNF Sbjct: 30 RDSARHGARVWLGTFNTAEDAARAYDRAAFGMRGQRAILNF 70
BLAST of CX298550 vs. ExPASy Swiss-Prot
Match: EF101_ARATH (Ethylene-responsive transcription factor 2 OS=Arabidopsis thaliana GN=ERF2 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.758e-11 Identity = 31/41 (75.61%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 386 RDSARHGQRIWLGTFETAKEAALAYDRAAFRMRGAKALLNF 508 RD A++G R+WLGTFETA++AALAYD AAFRMRG++ALLNF Sbjct: 133 RDPAKNGARVWLGTFETAEDAALAYDIAAFRMRGSRALLNF 173
BLAST of CX298550 vs. ExPASy Swiss-Prot
Match: ERF1_SOLLC (Ethylene-responsive transcription factor 1 OS=Solanum lycopersicum GN=ERF1 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.024e-11 Identity = 30/41 (73.17%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 386 RDSARHGQRIWLGTFETAKEAALAYDRAAFRMRGAKALLNF 508 RD A++G R+WLGT+E+A+EAALAY +AAFRMRG KALLNF Sbjct: 123 RDPAKNGARVWLGTYESAEEAALAYGKAAFRMRGTKALLNF 163 The following BLAST results are available for this feature:
BLAST of CX298550 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 7
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX298550 ID=CX298550; Name=CX298550; organism=Citrus clementina; type=EST; length=683bpback to top |