CX300624
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX300624 vs. ExPASy Swiss-Prot
Match: G3PB_ARATH (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2) HSP 1 Score: 82.0333 bits (201), Expect = 1.028e-15 Identity = 36/43 (83.72%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 3 QSVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYE 131 Q VVDLAHLVA+KWPG A GSGDPLEDFC+TNPADEECKVY+ Sbjct: 405 QRVVDLAHLVASKWPGAEAVGSGDPLEDFCKTNPADEECKVYD 447
BLAST of CX300624 vs. ExPASy Swiss-Prot
Match: G3PB_PEA (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2) HSP 1 Score: 81.2629 bits (199), Expect = 1.754e-15 Identity = 36/43 (83.72%), Postives = 37/43 (86.05%), Query Frame = 3 Query: 3 QSVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYE 131 Q VVDLAHLVA KWPG GSGDPLEDFC+TNPADEECKVYE Sbjct: 409 QRVVDLAHLVANKWPGTPKVGSGDPLEDFCETNPADEECKVYE 451
BLAST of CX300624 vs. ExPASy Swiss-Prot
Match: G3PB_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 9.006e-12 Identity = 32/44 (72.73%), Postives = 35/44 (79.55%), Query Frame = 3 Query: 3 QSVVDLAHLVATKWPGVAAG-GSGDPLEDFCQTNPADEECKVYE 131 Q VVDLA LVA KWPG+ SGDPLEDFC+ NPADEECK+YE Sbjct: 408 QRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE 451 The following BLAST results are available for this feature:
BLAST of CX300624 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300624 ID=CX300624; Name=CX300624; organism=Citrus clementina; type=EST; length=291bpback to top |