CX306136
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX306136 vs. ExPASy Swiss-Prot
Match: PSAEA_NICSY (Photosystem I reaction center subunit IV A, chloroplastic OS=Nicotiana sylvestris GN=PSAEA PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.759e-12 Identity = 32/34 (94.12%), Postives = 33/34 (97.06%), Query Frame = -3 Query: 65 DPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 166 DP +RYPVVVRFNKVNYANVSTNNYALDEIEEVK Sbjct: 108 DPNTRYPVVVRFNKVNYANVSTNNYALDEIEEVK 141
BLAST of CX306136 vs. ExPASy Swiss-Prot
Match: PSAEB_NICSY (Photosystem I reaction center subunit IV B, chloroplastic OS=Nicotiana sylvestris GN=PSAEB PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.828e-12 Identity = 31/34 (91.18%), Postives = 33/34 (97.06%), Query Frame = -3 Query: 65 DPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 166 DP +RYPVVVRFNKVNYANVSTNNYALDE+EEVK Sbjct: 110 DPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK 143
BLAST of CX306136 vs. ExPASy Swiss-Prot
Match: PSAE_SPIOL (Photosystem I reaction center subunit IV, chloroplastic OS=Spinacia oleracea GN=PSAE-1 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.506e-11 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = -3 Query: 68 DPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 166 DPK+RYPVVVRFNKVNYANVSTNNYALDEI+EV Sbjct: 92 DPKTRYPVVVRFNKVNYANVSTNNYALDEIQEV 124
BLAST of CX306136 vs. ExPASy Swiss-Prot
Match: PSAE2_ARATH (Photosystem I reaction center subunit IV B, chloroplastic OS=Arabidopsis thaliana GN=PSAE2 PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.569e-11 Identity = 30/34 (88.24%), Postives = 33/34 (97.06%), Query Frame = -3 Query: 65 DPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 166 DPK+RYPVVVRF KVNYAN+STNNYALDE+EEVK Sbjct: 112 DPKTRYPVVVRFAKVNYANISTNNYALDEVEEVK 145
BLAST of CX306136 vs. ExPASy Swiss-Prot
Match: PSAE1_ARATH (Photosystem I reaction center subunit IV A, chloroplastic OS=Arabidopsis thaliana GN=PSAE1 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.761e-11 Identity = 29/33 (87.88%), Postives = 32/33 (96.97%), Query Frame = -3 Query: 68 DPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 166 DPK+RYPVVVRF KVNYAN+STNNYALDE+EEV Sbjct: 109 DPKTRYPVVVRFAKVNYANISTNNYALDEVEEV 141 The following BLAST results are available for this feature:
BLAST of CX306136 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX306136 ID=CX306136; Name=CX306136; organism=Citrus clementina; type=EST; length=171bpback to top |