CX308527

Overview
NameCX308527
Unique NameCX308527
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length446
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBL1_GOSHI (Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum GN=HB1 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 9.035e-56
Identity = 108/123 (87.80%), Postives = 114/123 (92.68%), Query Frame = 1
Query:   76 EGRAFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            EG+ FTEE EALVV+SW VMKK   ELGLKFFL+IFEIAPSA+KLFSFLRDSNVPLEQN KLKPHAMSVFVMTCESAVQLRKAGKVTVRES LKKLGA HFKYGVV+EHFEVTKF+LLETIKE
Sbjct:    5 EGKVFTEEQEALVVKSWTVMKKKTAELGLKFFLKIFEIAPSAKKLFSFLRDSNVPLEQNTKLKPHAMSVFVMTCESAVQLRKAGKVTVRESNLKKLGATHFKYGVVDEHFEVTKFALLETIKE 127          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBP2_CASGL (Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 3.796e-54
Identity = 105/123 (85.37%), Postives = 115/123 (93.50%), Query Frame = 1
Query:   76 EGRAFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            EGR FTEE EALVV+SW+ MK NAGELGLKFFL+IFEIAPSAQKLFSFL+DSNVPLE+N KLK HAMSVF+MTCESAVQLRKAGKVTVRES+LKKLGA HFK+GV +EHFEVTKF+LLETIKE
Sbjct:    5 EGRGFTEEQEALVVKSWSAMKPNAGELGLKFFLKIFEIAPSAQKLFSFLKDSNVPLERNPKLKSHAMSVFLMTCESAVQLRKAGKVTVRESSLKKLGASHFKHGVADEHFEVTKFALLETIKE 127          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBL1_MEDSA (Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=MHB1 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 2.461e-53
Identity = 103/121 (85.12%), Postives = 113/121 (93.39%), Query Frame = 1
Query:   82 RAFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            + FTEE EALVV+SWN MKKN+ ELGLK FL+IFEIAPSAQKLFSFL+DS VPLEQN KLKPHAMSVF+MTCESAVQLRK+GKVTVRES+LKKLGA HFKYGVV+EHFEVTKF+LLETIKE
Sbjct:    7 KGFTEEQEALVVKSWNAMKKNSAELGLKLFLKIFEIAPSAQKLFSFLKDSKVPLEQNTKLKPHAMSVFLMTCESAVQLRKSGKVTVRESSLKKLGANHFKYGVVDEHFEVTKFALLETIKE 127          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBL_TRETO (Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB1 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 5.672e-50
Identity = 99/128 (77.34%), Postives = 114/128 (89.06%), Query Frame = 1
Query:   61 MANINEGRAFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            M++    + FTEE EALVV+SW VMKKN+ ELGLKFFL+IFEIAPSA+ LFS+L+DS +PLEQN KLKPHAM+VFVMTCESAVQLRKAGKVTVRES LK+LGA+HFK GVVNEHFE T+F+LLETIKE
Sbjct:    1 MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFE-TRFALLETIKE 127          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBPL_PARRI (Non-legume hemoglobin OS=Parasponia rigida PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 2.156e-49
Identity = 95/128 (74.22%), Postives = 113/128 (88.28%), Query Frame = 1
Query:   61 MANINEGRAFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            M++    + FTEE EALVV++W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L+DS VPLEQN KLKPHA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKE
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKE 128          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBPL_PARAD (Non-legume hemoglobin OS=Parasponia andersonii PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 2.156e-49
Identity = 95/128 (74.22%), Postives = 113/128 (88.28%), Query Frame = 1
Query:   61 MANINEGRAFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            M++    + FTEE EALVV++W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L+DS VPLEQN KLKPHA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKE
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKE 128          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBL1_ARATH (Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana GN=AHB1 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.825e-48
Identity = 95/125 (76.00%), Postives = 111/125 (88.80%), Query Frame = 1
Query:   73 NEGR-AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            +EG+  FTEE EALVV+SW+VMKKN+ ELGLK F++IFEIAP+ +K+FSFLRDS +P EQN KLKPHAMSVFVM CESAVQLRK GKVTVRE+TLK+LGA H KYGVV+EHFEV K++LLETIKE
Sbjct:    3 SEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKE 127          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBL_MAIZE (Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.969e-46
Identity = 91/130 (70.00%), Postives = 112/130 (86.15%), Query Frame = 1
Query:   58 SMANINEGRA-FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            ++A  ++G   F EE EALV++SW VMKK+A  LGL+FFL++FEIAPSA+++FSFLRDS+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKE
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAEQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKE 131          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBL_ZEAMP (Non-symbiotic hemoglobin OS=Zea mays subsp. parviglumis GN=HB PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 6.490e-46
Identity = 91/130 (70.00%), Postives = 112/130 (86.15%), Query Frame = 1
Query:   58 SMANINEGRA-FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            ++A  ++G   F EE EALV++SW VMKK+A  LGL+FFL++FEIAPSA+++FSFLRDS+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKE
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKE 131          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: HBL2_ORYSJ (Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. japonica GN=HB2 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.107e-45
Identity = 86/120 (71.67%), Postives = 109/120 (90.83%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            +F+EE EALV++SW +MKK++  +GL+FFL+IFE+APSA ++FSFLR+S+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVR++TLK+LGA HFKYGV + HFEVT+F+LLETIKE
Sbjct:   16 SFSEEQEALVLKSWAIMKKDSANIGLRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHFKYGVGDAHFEVTRFALLETIKE 135          
The following BLAST results are available for this feature:
BLAST of CX308527 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
HBL1_GOSHI9.035e-5687.80Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum G... [more]
HBP2_CASGL3.796e-5485.37Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1[more]
HBL1_MEDSA2.461e-5385.12Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=M... [more]
HBL_TRETO5.672e-5077.34Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB... [more]
HBPL_PARRI2.156e-4974.22Non-legume hemoglobin OS=Parasponia rigida PE=1 SV... [more]
HBPL_PARAD2.156e-4974.22Non-legume hemoglobin OS=Parasponia andersonii PE=... [more]
HBL1_ARATH1.825e-4876.00Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana... [more]
HBL_MAIZE4.969e-4670.00Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV... [more]
HBL_ZEAMP6.490e-4670.00Non-symbiotic hemoglobin OS=Zea mays subsp. parvig... [more]
HBL2_ORYSJ1.107e-4571.67Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001A01Rv AbsLeaSub1 Citrus clementina cDNA clone C21001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308527 ID=CX308527|Name=CX308527|organism=Citrus clementina|type=EST|length=446bp
GCGGGGATTCAACAACATTTTGTGTATCACATTCAATCCTCAGGTGTCCA
AAAGAAATCAATGGCCAACATTAACGAAGGTAGAGCCTTTACTGAAGAGT
AAGAAGCTTTAGTTGTCAGGTCATGGAATGTAATGAAGAAGAATGCTGGA
GAATTGGGTCTTAAATTCTTCTTGAGGATCTTTGAGATTGCACCATCAGC
CCAAAAGCTGTTCTCATTCTTGAGAGACTCAAATGTGCCTCTAGAGCAGA
ACCAGAAGCTCAAGCCCCACGCCATGTCTGTTTTTGTTATGACGTGTGAA
TCAGCAGTGCAACTGAGGAAAGCAGGCAAAGTGACAGTAAGAGAATCAAC
TCTAAAAAAATTAGGAGCTGTCCACTTCAAATATGGTGTTGTTAATGAGC
ATTTTGAGGTCACAAAATTTTCACTACTGGAAACCATAAAAGAGGC
back to top