CX308539

Overview
NameCX308539
Unique NameCX308539
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length445
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBL1_GOSHI (Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum GN=HB1 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.581e-57
Identity = 110/123 (89.43%), Postives = 115/123 (93.50%), Query Frame = 3
Query:   75 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            EG+ FTEEQEALVVKSW VMKK   ELGLKFFL+IFEIAPSA+KLFSFLRDSNVPLEQN KLKPHAMSVFVMTCESAVQLRKAGKVTVRES LKKLGA HFKYGVV+EHFEVTKF+LLETIKE
Sbjct:    5 EGKVFTEEQEALVVKSWTVMKKKTAELGLKFFLKIFEIAPSAKKLFSFLRDSNVPLEQNTKLKPHAMSVFVMTCESAVQLRKAGKVTVRESNLKKLGATHFKYGVVDEHFEVTKFALLETIKE 127          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBP2_CASGL (Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.504e-55
Identity = 107/123 (86.99%), Postives = 116/123 (94.31%), Query Frame = 3
Query:   75 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            EGR FTEEQEALVVKSW+ MK NAGELGLKFFL+IFEIAPSAQKLFSFL+DSNVPLE+N KLK HAMSVF+MTCESAVQLRKAGKVTVRES+LKKLGA HFK+GV +EHFEVTKF+LLETIKE
Sbjct:    5 EGRGFTEEQEALVVKSWSAMKPNAGELGLKFFLKIFEIAPSAQKLFSFLKDSNVPLERNPKLKSHAMSVFLMTCESAVQLRKAGKVTVRESSLKKLGASHFKHGVADEHFEVTKFALLETIKE 127          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBL1_MEDSA (Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=MHB1 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 9.752e-55
Identity = 105/121 (86.78%), Postives = 114/121 (94.21%), Query Frame = 3
Query:   81 RAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            + FTEEQEALVVKSWN MKKN+ ELGLK FL+IFEIAPSAQKLFSFL+DS VPLEQN KLKPHAMSVF+MTCESAVQLRK+GKVTVRES+LKKLGA HFKYGVV+EHFEVTKF+LLETIKE
Sbjct:    7 KGFTEEQEALVVKSWNAMKKNSAELGLKLFLKIFEIAPSAQKLFSFLKDSKVPLEQNTKLKPHAMSVFLMTCESAVQLRKSGKVTVRESSLKKLGANHFKYGVVDEHFEVTKFALLETIKE 127          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBL_TRETO (Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB1 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 2.248e-51
Identity = 101/128 (78.91%), Postives = 115/128 (89.84%), Query Frame = 3
Query:   60 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            M++    + FTEEQEALVVKSW VMKKN+ ELGLKFFL+IFEIAPSA+ LFS+L+DS +PLEQN KLKPHAM+VFVMTCESAVQLRKAGKVTVRES LK+LGA+HFK GVVNEHFE T+F+LLETIKE
Sbjct:    1 MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFE-TRFALLETIKE 127          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBPL_PARRI (Non-legume hemoglobin OS=Parasponia rigida PE=1 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 8.543e-51
Identity = 97/128 (75.78%), Postives = 114/128 (89.06%), Query Frame = 3
Query:   60 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            M++    + FTEEQEALVVK+W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L+DS VPLEQN KLKPHA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKE
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKE 128          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBPL_PARAD (Non-legume hemoglobin OS=Parasponia andersonii PE=1 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 8.543e-51
Identity = 97/128 (75.78%), Postives = 114/128 (89.06%), Query Frame = 3
Query:   60 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            M++    + FTEEQEALVVK+W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L+DS VPLEQN KLKPHA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKE
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKE 128          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBL1_ARATH (Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana GN=AHB1 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 7.232e-50
Identity = 97/125 (77.60%), Postives = 112/125 (89.60%), Query Frame = 3
Query:   72 NEGR-AFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            +EG+  FTEEQEALVVKSW+VMKKN+ ELGLK F++IFEIAP+ +K+FSFLRDS +P EQN KLKPHAMSVFVM CESAVQLRK GKVTVRE+TLK+LGA H KYGVV+EHFEV K++LLETIKE
Sbjct:    3 SEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKE 127          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBL_MAIZE (Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.969e-47
Identity = 93/130 (71.54%), Postives = 113/130 (86.92%), Query Frame = 3
Query:   57 SMANINEGRA-FTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            ++A  ++G   F EEQEALV+KSW VMKK+A  LGL+FFL++FEIAPSA+++FSFLRDS+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKE
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAEQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKE 131          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBL_ZEAMP (Non-symbiotic hemoglobin OS=Zea mays subsp. parviglumis GN=HB PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 2.572e-47
Identity = 93/130 (71.54%), Postives = 113/130 (86.92%), Query Frame = 3
Query:   57 SMANINEGRA-FTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            ++A  ++G   F EEQEALV+KSW VMKK+A  LGL+FFL++FEIAPSA+++FSFLRDS+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKE
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKE 131          
BLAST of CX308539 vs. ExPASy Swiss-Prot
Match: HBL2_ORYSJ (Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. japonica GN=HB2 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 4.388e-47
Identity = 88/120 (73.33%), Postives = 110/120 (91.67%), Query Frame = 3
Query:   84 AFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 443
            +F+EEQEALV+KSW +MKK++  +GL+FFL+IFE+APSA ++FSFLR+S+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVR++TLK+LGA HFKYGV + HFEVT+F+LLETIKE
Sbjct:   16 SFSEEQEALVLKSWAIMKKDSANIGLRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHFKYGVGDAHFEVTRFALLETIKE 135          
The following BLAST results are available for this feature:
BLAST of CX308539 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
HBL1_GOSHI3.581e-5789.43Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum G... [more]
HBP2_CASGL1.504e-5586.99Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1[more]
HBL1_MEDSA9.752e-5586.78Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=M... [more]
HBL_TRETO2.248e-5178.91Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB... [more]
HBPL_PARRI8.543e-5175.78Non-legume hemoglobin OS=Parasponia rigida PE=1 SV... [more]
HBPL_PARAD8.543e-5175.78Non-legume hemoglobin OS=Parasponia andersonii PE=... [more]
HBL1_ARATH7.232e-5077.60Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana... [more]
HBL_MAIZE1.969e-4771.54Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV... [more]
HBL_ZEAMP2.572e-4771.54Non-symbiotic hemoglobin OS=Zea mays subsp. parvig... [more]
HBL2_ORYSJ4.388e-4773.33Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001B02Rv AbsLeaSub1 Citrus clementina cDNA clone C21001B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308539 ID=CX308539|Name=CX308539|organism=Citrus clementina|type=EST|length=445bp
ACGGGATTCAACAACATTTTGTGTATCACATTCAATCCTCAGGTGTCCAA
AAGAAATCAATGGCCAACATTAACGAAGGTAGAGCCTTTACTGAAGAGCA
AGAAGCTTTAGTTGTCAAGTCATGGAATGTAATGAAGAAGAATGCTGGAG
AATTGGGTCTTAAATTCTTCTTGAGGATCTTTGAGATTGCACCATCAGCC
CAAAAGCTGTTCTCATTCTTGAGAGACTCAAATGTGCCTCTAGAGCAGAA
CCAGAAGCTCAAGCCCCACGCCATGTCTGTTTTTGTTATGACGTGTGAAT
CAGCAGTGCAACTGAGGAAAGCAGGCAAAGTGACAGTAAGAGAATCAACT
CTAAAAAAATTAGGAGCTGTCCACTTCAAATATGGTGTTGTTAATGAGCA
TTTTGAGGTCACAAAATTTTCACTACTGGAAACCATAAAAGAGGC
back to top