CX308579

Overview
NameCX308579
Unique NameCX308579
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length454
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig677 contig Ccv1_Contig677:400..853. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308579 vs. ExPASy Swiss-Prot
Match: TIF9_ARATH (Protein TIFY 9 OS=Arabidopsis thaliana GN=TIFY9 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.578e-18
Identity = 55/102 (53.92%), Postives = 68/102 (66.67%), Query Frame = -3
Query:  159 IPKSGSENVSETAPLTIFYNGTVAVFDVHREKAEHILKLAVEGNSKSFESN---DANV--ASDQQQQLLETLNTGDLPIARRKSLQRFLEKRKERLTLVSPY 449
            + +S +E VS T P+TIFYNG+V+VF V R KA  I+K+A E  SK  ES+   D +V   +  + +L      GDLPIARRKSLQRFLEKRKERL   SPY
Sbjct:   91 LARSSTELVSGTVPMTIFYNGSVSVFQVSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQNLEGDLPIARRKSLQRFLEKRKERLVSTSPY 192          
BLAST of CX308579 vs. ExPASy Swiss-Prot
Match: TI10A_ARATH (Protein TIFY 10A OS=Arabidopsis thaliana GN=TIFY10A PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.766e-12
Identity = 44/105 (41.90%), Postives = 61/105 (58.10%), Query Frame = -3
Query:  159 SETAPLTIFYNGTVAVF-DVHREKAEHILKLAVEGNSKSFESNDANVASD--------------QQQQLLETLNTG--DLPIARRKSLQRFLEKRKERLTLVSPY 422
            S+TAPLTIFY G V VF D   EKA+ ++ LA +G + S   N  ++ S+                Q+ +++  T   +LPIARR SL RFLEKRK+R+T  +PY
Sbjct:  122 SQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPY 226          
BLAST of CX308579 vs. ExPASy Swiss-Prot
Match: TI10B_ARATH (Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10B PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.441e-11
Identity = 45/114 (39.47%), Postives = 63/114 (55.26%), Query Frame = -3
Query:  159 SETAPLTIFYNGTVAVFD-VHREKAEHILKLAVEGNSKSFESNDANVASDQ----QQQLLETLN---------------------TGDLPIARRKSLQRFLEKRKERLTLVSPY 422
            S++APLTIFY G V VFD    EKA+ ++ LA +G++KSF    A V ++     Q+++  + N                       +LPIARR SL RFLEKRK+R+T  +PY
Sbjct:  115 SQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPY 228          
The following BLAST results are available for this feature:
BLAST of CX308579 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
TIF9_ARATH1.578e-1853.92Protein TIFY 9 OS=Arabidopsis thaliana GN=TIFY9 PE... [more]
TI10A_ARATH3.766e-1241.90Protein TIFY 10A OS=Arabidopsis thaliana GN=TIFY10... [more]
TI10B_ARATH2.441e-1139.47Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21001E06Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308579 ID=CX308579|Name=CX308579|organism=Citrus clementina|type=EST|length=454bp
GACCAAAAGCTCACCCTCCGAAAAGATGGAAACAGAATTTCTACAAAACT
ACTCTTGTGCCCATTAACTTTCTCCTCTTTTTAGGCCGGCAATAACATCA
ATCTCCATTGATCTTCATGTCCCAATTACCAAAACGCGTTTTTTTAAGTG
TGGCATGAATAAGGAGACACCAAAGTCAATCTCTCTTTGCGTTTCTCCAG
AAATCTCTGGAGTGACTTTCTCCTCGCAATTGGCAGATCTCCAGTATTAA
GAGTCTCAAGCAGCTGTTGTTGCTGATCGCTTGCAACATTAGCATCATTT
GATTCGAAACTTTTTGAGTTTCCTTCAACAGCAAGTTTCAGAATGTGCTC
AGCCTTCTCTCGATGAACATCAAAAACAGCGACGGTTCCGTTATAAAATA
TAGTCAGAGGAGCTGTTTCCGAAACGTTCTCTGAACCAGACTTTGGAATG
TGCC
back to top