CX308599

Overview
NameCX308599
Unique NameCX308599
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length351
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14605 contig Ccv1_Contig14605:197..547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF_VIGUN (ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3)

HSP 1 Score: 236.498 bits (602), Expect = 3.254e-62
Identity = 115/116 (99.14%), Postives = 116/116 (100.00%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF2_ARATH (ADP-ribosylation factor 2 OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=3)

HSP 1 Score: 236.498 bits (602), Expect = 3.254e-62
Identity = 115/116 (99.14%), Postives = 116/116 (100.00%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF1_ARATH (ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 3.254e-62
Identity = 115/116 (99.14%), Postives = 116/116 (100.00%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF2_ORYSJ (ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2)

HSP 1 Score: 234.958 bits (598), Expect = 9.468e-62
Identity = 114/116 (98.28%), Postives = 116/116 (100.00%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF1_ORYSJ (ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3)

HSP 1 Score: 234.958 bits (598), Expect = 9.468e-62
Identity = 114/116 (98.28%), Postives = 116/116 (100.00%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF1_CHLRE (ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2)

HSP 1 Score: 234.958 bits (598), Expect = 9.468e-62
Identity = 114/116 (98.28%), Postives = 116/116 (100.00%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF1_DAUCA (ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 1.615e-61
Identity = 114/116 (98.28%), Postives = 115/116 (99.14%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEI DKLGLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEIIDKLGLHSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF_MAIZE (ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 2.109e-61
Identity = 114/116 (98.28%), Postives = 116/116 (100.00%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGL+SLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLNSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF1_SALBA (ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3)

HSP 1 Score: 233.802 bits (595), Expect = 2.109e-61
Identity = 114/116 (98.28%), Postives = 115/116 (99.14%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF1_CATRO (ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3)

HSP 1 Score: 229.18 bits (583), Expect = 5.195e-60
Identity = 112/116 (96.55%), Postives = 114/116 (98.28%), Query Frame = -3
Query:    2 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 349
            LKLGEIVTTIPTIGFNVETVEY+ ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDK GLHSLRQRH
Sbjct:   37 LKLGEIVTTIPTIGFNVETVEYQYISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKHGLHSLRQRH 152          
The following BLAST results are available for this feature:
BLAST of CX308599 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 212
Match NameE-valueIdentityDescription
ARF_VIGUN3.254e-6299.14ADP-ribosylation factor OS=Vigna unguiculata GN=AR... [more]
ARF2_ARATH3.254e-6299.14ADP-ribosylation factor 2 OS=Arabidopsis thaliana ... [more]
ARF1_ARATH3.254e-6299.14ADP-ribosylation factor 1 OS=Arabidopsis thaliana ... [more]
ARF2_ORYSJ9.468e-6298.28ADP-ribosylation factor 2 OS=Oryza sativa subsp. j... [more]
ARF1_ORYSJ9.468e-6298.28ADP-ribosylation factor 1 OS=Oryza sativa subsp. j... [more]
ARF1_CHLRE9.468e-6298.28ADP-ribosylation factor 1 OS=Chlamydomonas reinhar... [more]
ARF1_DAUCA1.615e-6198.28ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1... [more]
ARF_MAIZE2.109e-6198.28ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 S... [more]
ARF1_SALBA2.109e-6198.28ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 P... [more]
ARF1_CATRO5.195e-6096.55ADP-ribosylation factor 1 OS=Catharanthus roseus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001G02Rv AbsLeaSub1 Citrus clementina cDNA clone C21001G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308599 ID=CX308599|Name=CX308599|organism=Citrus clementina|type=EST|length=351bp
AGTGGCGCTGCCTGAGGGAGTGGAGGCCAAGCTTATCAGTAATCTCAGCA
GCATTCATTGCATTTGGAAGATCCTGTTTGTTAGCAAATACAAGCAACAC
TGCATCTCGCAGCTCATCCTCATTCAACATCCTATGCAATTCATCCCTTG
CTTCTACAATACGGTCTCTGTCATTGCTGTCCACAACAAAAATGAGACCT
TGAGTGTTCTGGAAATAATGCCTCCACAAGGGACGAATCTTGTCCTGGCC
ACCAACATCCCACACAGTGAAACTGATGTTTTTATATTCAACGGTCTCCA
CATTAAACCCAATGGTAGGAATTGTGGTGACAATCTCTCCAAGCTTGAGC
T
back to top