CX308859

Overview
NameCX308859
Unique NameCX308859
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length254
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7296 contig Ccv1_Contig7296:448..701. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308859 vs. ExPASy Swiss-Prot
Match: Y4523_ARATH (Probable serine/threonine-protein kinase At4g35230 OS=Arabidopsis thaliana GN=At4g35230 PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.061e-37
Identity = 75/84 (89.29%), Postives = 79/84 (94.05%), Query Frame = -1
Query:    3 NLAYTPPEYLKNGRVIPESVIYSFGTVLLDLLSGKHIPPSHALDMIRGENLNLLMDSHLEGKFSSEEATQVVGLASQCLQYEPR 254
            NLAYTPPEYL+NGRV PESV YSFGTVLLDLLSGKHIPPSHALDMIRG+N+ LLMDSHLEGKFS+EEAT VV LASQCLQYEPR
Sbjct:  232 NLAYTPPEYLRNGRVTPESVTYSFGTVLLDLLSGKHIPPSHALDMIRGKNIILLMDSHLEGKFSTEEATVVVELASQCLQYEPR 315          
BLAST of CX308859 vs. ExPASy Swiss-Prot
Match: Y5126_ARATH (Probable serine/threonine-protein kinase At5g41260 OS=Arabidopsis thaliana GN=At5g41260 PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.996e-32
Identity = 63/84 (75.00%), Postives = 76/84 (90.48%), Query Frame = -1
Query:    3 NLAYTPPEYLKNGRVIPESVIYSFGTVLLDLLSGKHIPPSHALDMIRGENLNLLMDSHLEGKFSSEEATQVVGLASQCLQYEPR 254
            NLA+TPPEYL+ GRV PESVIYSFGT+LLDLLSGKHIPPSHALD+IR  N+ +LMDS LEG+FSS++ T+++ LAS+CLQYEPR
Sbjct:  215 NLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPR 298          
BLAST of CX308859 vs. ExPASy Swiss-Prot
Match: SSP_ARATH (Probable inactive receptor-like kinase SSP OS=Arabidopsis thaliana GN=SSP PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.773e-18
Identity = 45/75 (60.00%), Postives = 57/75 (76.00%), Query Frame = -1
Query:    9 EYLKNGRVIPESVIYSFGTVLLDLLSGKHIPPSHALDMIRGENLNLLMDSHLEGKFSSEEATQVVGLASQCLQYE 233
            + +  G V PE+VIY FGTVL++LLSGK IPPSHA +MI  +N+  LMD +L+GKFS +EA  V  LASQCL+YE
Sbjct:  200 DQITTGSVNPENVIYRFGTVLVNLLSGKQIPPSHAPEMIHRKNVFKLMDPYLKGKFSIDEANVVYKLASQCLKYE 274          
The following BLAST results are available for this feature:
BLAST of CX308859 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
Y4523_ARATH2.061e-3789.29Probable serine/threonine-protein kinase At4g35230... [more]
Y5126_ARATH1.996e-3275.00Probable serine/threonine-protein kinase At5g41260... [more]
SSP_ARATH4.773e-1860.00Probable inactive receptor-like kinase SSP OS=Arab... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21004F08Rv AbsLeaSub1 Citrus clementina cDNA clone C21004F08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308859 ID=CX308859|Name=CX308859|organism=Citrus clementina|type=EST|length=254bp
TCCCTGGGTTCATATTGCAAACATTGCGAGGCAAGGCCAACCACCTGTGT
TGCTTCTTCAGAAGAAAATTTTCCTTCCAAATGTGAATCCATTAAGAGAT
TGAGGTTTTCACCCCTTATCATATCAAGAGCATGACTTGGAGGGATATGC
TTTCCACTTAACAAATCCAGAAGCACAGTTCCAAAGCTGTATATAACACT
CTCAGGAATGACCCTTCCATTCTTTAGATACTCTGGAGGTGTATAGGCCA
GATT
back to top