CX308872

Overview
NameCX308872
Unique NameCX308872
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length308
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9835 contig Ccv1_Contig9835:8..315. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: PR4B_TOBAC (Pathogenesis-related protein PR-4B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.823e-26
Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = -3
Query:    1 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNS 186
            TYHLY+P+ I WDL AASAFCATWDA+KPLAWRQKYGWTAFC   GP GQ +CGRCLRVTN+
Sbjct:   34 TYHLYNPQNINWDLRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDSCGRCLRVTNT 95          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: PR4A_TOBAC (Pathogenesis-related protein PR-4A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.823e-26
Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = -3
Query:    1 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNS 186
            TYHLY+P+ I WDL AASAFCATWDA+KPLAWRQKYGWTAFC   GP GQ +CGRCLRVTN+
Sbjct:   34 TYHLYNPQNINWDLRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDSCGRCLRVTNT 95          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: PRP2_SOLLC (Pathogenesis-related protein P2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.549e-24
Identity = 44/62 (70.97%), Postives = 52/62 (83.87%), Query Frame = -3
Query:    1 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNS 186
            TYHLY+P+ I WDL  AS +CATWDA+KPL WR++YGWTAFC   GP GQA+CGRCLRVTN+
Sbjct:   32 TYHLYNPQNINWDLRTASVYCATWDADKPLEWRRRYGWTAFCGPAGPTGQASCGRCLRVTNT 93          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: WIN1_SOLTU (Wound-induced protein WIN1 OS=Solanum tuberosum GN=WIN1 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.451e-24
Identity = 42/62 (67.74%), Postives = 54/62 (87.10%), Query Frame = -3
Query:    1 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNS 186
            TYH+Y+P+ +GWDL A SA+C+TWDANKPL+WR+KYGWTAFC   GP G+ +CG+CLRVTN+
Sbjct:   86 TYHIYNPQNVGWDLNAVSAYCSTWDANKPLSWRKKYGWTAFCGPVGPRGRDSCGKCLRVTNT 147          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: WIN2_SOLTU (Wound-induced protein WIN2 OS=Solanum tuberosum GN=WIN2 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 7.689e-24
Identity = 42/62 (67.74%), Postives = 52/62 (83.87%), Query Frame = -3
Query:    1 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNS 186
            TYH+Y+P+ +GWDL A SA+C+TWDANKP AWR KYGWTAFC   GP G+ +CG+CLRVTN+
Sbjct:   85 TYHIYNPQNVGWDLNAVSAYCSTWDANKPYAWRSKYGWTAFCGPVGPRGRDSCGKCLRVTNT 146          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: HEVL_ARATH (Hevein-like protein OS=Arabidopsis thaliana GN=HEL PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.450e-22
Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = -3
Query:    1 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNS 186
            TYH Y+P Q  WDL A SA+C+TWDA+KP AWR KYGWTAFC   GP GQA+CG+CLRV N+
Sbjct:   80 TYHFYNPAQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQASCGKCLRVKNT 141          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: BARW_HORVU (Barwin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.473e-22
Identity = 45/63 (71.43%), Postives = 49/63 (77.78%), Query Frame = -3
Query:    4 TYHLYHPEQIGWDL--TAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTN 186
            TYH Y P Q  WDL   A SA+CATWDA+KPL+WR KYGWTAFC   GP GQAACG+CLRVTN
Sbjct:    9 TYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPRGQAACGKCLRVTN 71          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: HEVE_HEVBR (Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 9.399e-22
Identity = 41/62 (66.13%), Postives = 50/62 (80.65%), Query Frame = -3
Query:    1 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNS 186
            TYHLY+ +  GWDL AASA+C+TWDANKP +WR KYGWTAFC   G  GQ++CG+CL VTN+
Sbjct:   76 TYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNT 137          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: WHW2_WHEAT (Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.094e-21
Identity = 44/63 (69.84%), Postives = 48/63 (76.19%), Query Frame = -3
Query:    4 TYHLYHPEQIGWDL--TAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTN 186
            TYH Y P Q  WDL   A SA+CATWDA+KPL+WR KYGWTAFC   G  GQAACG+CLRVTN
Sbjct:   32 TYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQAACGKCLRVTN 94          
BLAST of CX308872 vs. ExPASy Swiss-Prot
Match: WHW1_WHEAT (Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.357e-20
Identity = 42/63 (66.67%), Postives = 48/63 (76.19%), Query Frame = -3
Query:    4 TYHLYHPEQIGWDL--TAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTN 186
            TYH Y P Q  WDL   A SA+CATWDA+KPL+WR KYGWTAFC   G  GQA+CG+CL+VTN
Sbjct:   30 TYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQASCGKCLQVTN 92          
The following BLAST results are available for this feature:
BLAST of CX308872 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
PR4B_TOBAC2.823e-2679.03Pathogenesis-related protein PR-4B OS=Nicotiana ta... [more]
PR4A_TOBAC2.823e-2679.03Pathogenesis-related protein PR-4A OS=Nicotiana ta... [more]
PRP2_SOLLC1.549e-2470.97Pathogenesis-related protein P2 OS=Solanum lycoper... [more]
WIN1_SOLTU3.451e-2467.74Wound-induced protein WIN1 OS=Solanum tuberosum GN... [more]
WIN2_SOLTU7.689e-2467.74Wound-induced protein WIN2 OS=Solanum tuberosum GN... [more]
HEVL_ARATH1.450e-2267.74Hevein-like protein OS=Arabidopsis thaliana GN=HEL... [more]
BARW_HORVU2.473e-2271.43Barwin OS=Hordeum vulgare PE=1 SV=1[more]
HEVE_HEVBR9.399e-2266.13Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2[more]
WHW2_WHEAT2.094e-2169.84Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1[more]
WHW1_WHEAT1.357e-2066.67Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21004G11Rv AbsLeaSub1 Citrus clementina cDNA clone C21004G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308872 ID=CX308872|Name=CX308872|organism=Citrus clementina|type=EST|length=308bp
ACTGTTTGTGACCCTTAAGCACCTGCCACAAGCAGCTTGTCCAATGGGTC
CGCCCGAATGACAGAAAGCAGTCCAGCCATATTTCTGGCGCCAGGCCAAG
GGCTTGTTGGCATCCCATGTTGCGCAGAAAGCGCTCGCTGCCGTCAAGTC
CCATCCAATTTGCTCAGGGTGGTAGAGATGATACGTGGCTCTCACATTAG
AAGCACTTTGGGCAGAAGCAGCTGCCACCAGTAGACAAACTGACAGAATC
ACACAGAGACCGAACCTCCCCATATTTTTCTCTTAATGTTCTAAGCTTAA
CTTCCCCG
back to top