CX308876

Overview
NameCX308876
Unique NameCX308876
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length374
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX308876_ssr343 microsatellite CX308876_ssr343:343..362. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig425 contig Ccv1_Contig425:1..365. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI1_SALBA (Protein translation factor SUI1 homolog OS=Salix bakko PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 8.386e-31
Identity = 61/70 (87.14%), Postives = 66/70 (94.29%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            MSEFD  IP+ FDPFAEANAEDSGAG+KDYVH+RVQQRNGRKSLTTVQGLKK++SYNKILKD KKEFCCN
Sbjct:    1 MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKEFCCN 70          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI1_BRAOL (Protein translation factor SUI1 homolog OS=Brassica oleracea PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 9.272e-30
Identity = 59/70 (84.29%), Postives = 66/70 (94.29%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            MSE D+Q+P+ FDPFA+ANAEDSGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KILKD KKEFCCN
Sbjct:    1 MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCN 70          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI11_ARATH (Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana GN=At4g27130 PE=2 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 9.272e-30
Identity = 59/70 (84.29%), Postives = 66/70 (94.29%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            MSE D+Q+P+ FDPFA+ANAEDSGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KILKD KKEFCCN
Sbjct:    1 MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCN 70          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI1_ORYSJ (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. japonica GN=GOS2 PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.010e-29
Identity = 61/72 (84.72%), Postives = 65/72 (90.28%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            MS+ D QIP+ FDPFAEANA DSGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKD KKEFCCN
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN 72          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI1_ORYSI (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. indica GN=GOS2 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.010e-29
Identity = 61/72 (84.72%), Postives = 65/72 (90.28%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            MS+ D QIP+ FDPFAEANA DSGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKD KKEFCCN
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN 72          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI12_ARATH (Protein translation factor SUI1 homolog 2 OS=Arabidopsis thaliana GN=At1g54290 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.010e-29
Identity = 57/70 (81.43%), Postives = 66/70 (94.29%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            MS+ + Q+P+ FDPFA+ANAEDSGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KILKD KKEFCCN
Sbjct:    1 MSDLEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFCCN 70          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI1_SPOST (Protein translation factor SUI1 homolog OS=Sporobolus stapfianus PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.339e-28
Identity = 60/72 (83.33%), Postives = 65/72 (90.28%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            MS+ D QIP+ FDPF+EANA DSGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKD KKEFCCN
Sbjct:    1 MSDLDIQIPTAFDPFSEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN 72          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI1_MAIZE (Protein translation factor SUI1 homolog OS=Zea mays GN=TIF PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.284e-28
Identity = 60/72 (83.33%), Postives = 65/72 (90.28%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            MS+ D QIP+ FDPFAEANA DSGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+KILKD KKEFCCN
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCN 72          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: SUI1_PIMBR (Protein translation factor SUI1 homolog OS=Pimpinella brachycarpa PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.098e-22
Identity = 49/70 (70.00%), Postives = 57/70 (81.43%), Query Frame = -3
Query:    1 MSEFDTQIPSTFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 210
            M + D QIP++FDPFAEA   D+   +K+YVHIR+QQRNGRKSLTTVQGLKKE SY+KILKD KK  CCN
Sbjct:    1 MVDSDIQIPTSFDPFAEAEITDATGSTKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKILKDLKKALCCN 70          
BLAST of CX308876 vs. ExPASy Swiss-Prot
Match: EIF1_PONAB (Eukaryotic translation initiation factor 1 OS=Pongo abelii GN=EIF1 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.589e-13
Identity = 34/62 (54.84%), Postives = 48/62 (77.42%), Query Frame = -3
Query:    1 TFDPFAEANAEDS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDPKKEFCCN 180
            +FDPFA+A+  D    AG++DY+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CN
Sbjct:    9 SFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN 70          
The following BLAST results are available for this feature:
BLAST of CX308876 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
SUI1_SALBA8.386e-3187.14Protein translation factor SUI1 homolog OS=Salix b... [more]
SUI1_BRAOL9.272e-3084.29Protein translation factor SUI1 homolog OS=Brassic... [more]
SUI11_ARATH9.272e-3084.29Protein translation factor SUI1 homolog 1 OS=Arabi... [more]
SUI1_ORYSJ6.010e-2984.72Protein translation factor SUI1 homolog OS=Oryza s... [more]
SUI1_ORYSI6.010e-2984.72Protein translation factor SUI1 homolog OS=Oryza s... [more]
SUI12_ARATH6.010e-2981.43Protein translation factor SUI1 homolog 2 OS=Arabi... [more]
SUI1_SPOST1.339e-2883.33Protein translation factor SUI1 homolog OS=Sporobo... [more]
SUI1_MAIZE2.284e-2883.33Protein translation factor SUI1 homolog OS=Zea may... [more]
SUI1_PIMBR1.098e-2270.00Protein translation factor SUI1 homolog OS=Pimpine... [more]
EIF1_PONAB1.589e-1354.84Eukaryotic translation initiation factor 1 OS=Pong... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21004H03Rv AbsLeaSub1 Citrus clementina cDNA clone C21004H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308876 ID=CX308876|Name=CX308876|organism=Citrus clementina|type=EST|length=374bp
ATTACAGCAGAACTCTTTCTTGGGGTCCTTGAGAATCTTGTTGTAGCTGA
ATTCTTTCTTCAACCCTTGCACAGTTGTCAGGCTTTTCCTCCCATTACGT
TGCTGCACGCGAATATGCACATAATCTTTTGAACCAGCACCTGAGTCCTC
AGCATTTGCCTCAGCAAAGGGATCAAAGGTAGATGGAATCTGGGTGTCAA
ATTCAGACATGAAGCTTGGTTGTTGGAGTGTCAAAGAGTCCGTAACCAGC
AAGAAATTGGCTTCAATTCACTTAAATTGCTCTTAGCTTAAGAGGAAGAT
TGCGAATCAAACTGCCTTACGAGAGCGGAAACAAGAGAAGCCAGAGAGAG
AGAGAGAGAGAGACAGAGATCCCG
back to top