DY257733

Overview
NameDY257733
Unique NameDY257733
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length891
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig860 contig Ccv1_Contig860:6..896. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY257733 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.856e-30
Identity = 74/199 (37.19%), Postives = 114/199 (57.29%), Query Frame = 3
Query:   57 ATTLSFLILALASNSLLVLGTSSVPEPLLDVNGNKVQSTLKYYIVSAIWXXXXXXXXXXXXXXXYCPLDVIQLPSDMQNGIELTLSPYNNST-IVRKSTDLNLRFSVLLSGRD-YCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGR-SFEDGVRRLVL 644
            AT +  L+ A  S S      ++   P+LD +G+++Q+ ++YY++S+I                 CP  V+Q  SD+ NG  +  S  ++   +VR STD+N+ F  +   RD  C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC   C+++GR S +DG  RL L
Sbjct:    4 ATAVVLLLFAFTSKSYFFGVANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL--GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of DY257733 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 121.709 bits (304), Expect = 5.590e-27
Identity = 72/210 (34.29%), Postives = 110/210 (52.38%), Query Frame = 3
Query:   48 ISLATTLSFLILALASNSLLVLGTSSVPEPLLDVNGNKVQSTLKYYIVSAI--WXXXXXXXXXXXXXXXYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRKSTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGRSFEDGVRRLVLVRDDEPAF 668
            +SL+      +LA A+N LL     S P P+LD++G K+++   YYIV  +                   CP  V+Q   ++ +   L   P N    +VR STDLN+ FS  +  R       +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:    7 LSLSFFFVSALLAAAANPLLS-AADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
BLAST of DY257733 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.742e-20
Identity = 64/179 (35.75%), Postives = 94/179 (52.51%), Query Frame = 3
Query:  129 PEPLLDVNGNKVQSTLKYYIVSAIW-XXXXXXXXXXXXXXXYCPLDVIQLPSDMQNGIELTLSPYNN--STIVRKSTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGRSFED-GVRRLVLVRD 653
            P+P++D++G  V   + Y++VSAIW                 CPL V+Q P D  NG  +  S   N    IV +S DLN++F++ ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K G  P +YK   CPS   + +  CNNV   F+   +RRL+L  D
Sbjct:    3 PKPIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFD--NGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
BLAST of DY257733 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 7.087e-14
Identity = 57/185 (30.81%), Postives = 88/185 (47.57%), Query Frame = 3
Query:  132 EPLLDVNGNKVQSTLKYYIVSAIWXXXXXXXXXXXXXXXYCPLDVIQLPSDMQNGIELTLS-PYNNSTIVRKSTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGRSFEDGVRRLVLVRDDEPAFPVVLI 683
            E + D+ G  V    +YYIVSAI                 CP+ +IQ  SD+Q G+ +  S P  +   +   T+L + F      +  C E   W +      SG+  +  GG + HP  E +  +FK+EK+G+    YK+V CP   +S    C+++G ++E G R LVL   D+  F VV +
Sbjct:    4 EKVYDIEGYPVFLGSEYYIVSAIIGAGGGGVRPGRTRGSMCPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEFVE----KPDCAESSKWVIVK---DSGEARVAIGGSEDHPQGELVRGFFKIEKLGSL--AYKLVFCP---KSSSGSCSDIGINYE-GRRSLVLKSSDDSPFRVVFV 175          
BLAST of DY257733 vs. ExPASy Swiss-Prot
Match: SPORB_IPOBA (Sporamin B OS=Ipomoea batatas GN=GSPO-B1 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.836e-13
Identity = 59/193 (30.57%), Postives = 90/193 (46.63%), Query Frame = 3
Query:  117 TSSVPEPLLDVNGNKVQSTLKYYIVSAIW--XXXXXXXXXXXXXXXYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRKSTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 686
            T+S   P+LD+NG++V++   YYIVSAIW                  C  DVI   SD  NG  +T++P +  +T+V  ST    RF++  +    C     W +  +D+ SG++F+  G            N FK+E + +    YKI    S C+   + C NVGR ++   R   L   + P F  V+ P
Sbjct:   34 TASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNI--ATNKLCVNNVNWGI-KHDSESGQYFVKAGEF-----VSDNSNQFKIEVVNDNLNAYKI----SYCQFGTEKCFNVGRYYDPLTRATRLALSNTP-FVFVIKP 213          
BLAST of DY257733 vs. ExPASy Swiss-Prot
Match: SPOR1_IPOBA (Sporamin A OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.337e-12
Identity = 57/193 (29.53%), Postives = 90/193 (46.63%), Query Frame = 3
Query:  120 SSVPEPLLDVNGNKVQSTLKYYIVSAIW-XXXXXXXXXXXXXXXYCPLDVIQLPSDMQNGIELTLSPYN---NSTIVRKSTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 686
            +S   P+LD+NG++V++   YY+VSAIW                 C  DVI  P+D+ NG  +T++P      ST+V  ST    RF++  +    C     W +  +D+ASG++F+  G            N FK+E +     +YK+ +C    + C     NVGR  +  +R   L   + P F  V+ P
Sbjct:   37 ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNI--ATNKLCVNNVNWGI-QHDSASGQYFLKAGEF-----VSDNSNQFKIELVDANLNSYKLTYCQFGSDKCY----NVGRFHDHMLRTTRLALSNSP-FVFVIKP 216          
BLAST of DY257733 vs. ExPASy Swiss-Prot
Match: SPOR2_IPOBA (Sporamin B OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.978e-12
Identity = 58/193 (30.05%), Postives = 90/193 (46.63%), Query Frame = 3
Query:  117 TSSVPEPLLDVNGNKVQSTLKYYIVSAIW--XXXXXXXXXXXXXXXYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRKSTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 686
            T+S   P+LD+NG++V++   YY+VSAIW                  C  DVI   SD  NG  +T++P +  +T+V  ST    RF++  +    C     W +  +D+ SG++F+  G            N FK+E + +    YKI    S C+   + C NVGR ++   R   L   + P F  V+ P
Sbjct:   34 TASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNI--ATNKLCVNNVNWGI-KHDSESGQYFVKAGEF-----VSDNSNQFKIEVVNDNLNAYKI----SYCQFGTEKCFNVGRYYDPLTRATRLALSNIP-FVFVIKP 213          
The following BLAST results are available for this feature:
BLAST of DY257733 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
ASP_THECC1.856e-3037.1921 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU5.590e-2734.29Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA1.742e-2035.75Latex serine proteinase inhibitor OS=Carica papaya... [more]
DRTI_DELRE7.087e-1430.81Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
SPORB_IPOBA7.836e-1330.57Sporamin B OS=Ipomoea batatas GN=GSPO-B1 PE=2 SV=1[more]
SPOR1_IPOBA1.337e-1229.53Sporamin A OS=Ipomoea batatas PE=2 SV=1[more]
SPOR2_IPOBA2.978e-1230.05Sporamin B OS=Ipomoea batatas PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAB1AF07ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY257733 ID=DY257733|Name=DY257733|organism=Citrus clementina|type=EST|length=891bp
GAACGCGCATCAAACAGATATATAGCTTTGAAAACAACAAAATGAAGATT
TCATTAGCAACAACACTCTCTTTCCTTATCCTTGCCTTGGCCTCAAACTC
TTTGTTGGTCTTGGGCACCTCATCAGTTCCTGAACCTCTCCTTGATGTCA
ACGGCAACAAGGTCCAATCCACCCTTAAGTACTACATAGTCTCAGCCATC
TGGGGAGCTGGCGGTGGTGGAGTTAGCCTACACGGTGGCAAAAACGGATA
TTGTCCGCTGGACGTTATCCAATTACCTTCTGATATGCAAAATGGAATCG
AATTAACACTGTCACCGTATAACAATTCTACAATTGTCCGAAAATCCACT
GATCTCAACTTGAGATTCTCAGTGTTGCTATCTGGACGTGACTATTGTAA
CGAACAACCGTTGTGGAAAGTTGATAATTATGACGCTGCATCAGGCAAAT
GGTTTATAACAACCGGGGGACTTGATGGTCATCCTGGAGCTGAAACTTTG
CTAAATTGGTTTAAGCTTGAGAAAATTGGAAATTTTCCAGGTACATACAA
AATCGTTCATTGTCCATCCGTTTGCGAGTCTTGTGTCAAACACTGCAACA
ACGTTGGCCGTTCGTTTGAGGATGGCGTTCGACGTCTGGTTCTGGTTCGT
GATGATGAGCCGGCATTTCCTGTTGTGTTAATTCCCGCTACAGAAAGATC
AACGTCTGTGTAATCAATGTACCCTAACCAGCTAGCGGTATTATTATTCT
AAATAACGGACCAGGCTAGCTGCTCTTTAATCTCAAGGATTAAAATTATG
AAAAAGTACCCTGTGATCCTTTTCGGGTTAATAAATTCTACTGTTGGTGT
AAACCTTATGAAAATCCAAATCAAGTGTTCTTTGTTTTGAT
back to top