FC875475

Overview
NameFC875475
Unique NameFC875475
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length665
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14430 contig Ccv1_Contig14430:35..699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_PYRHO (Probable aminomethyltransferase OS=Pyrococcus horikoshii GN=gcvT PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 8.980e-12
Identity = 41/147 (27.89%), Postives = 77/147 (52.38%), Query Frame = 3
Query:  219 LKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLA---HIEAHMKSFTAKGGDVSWHIHD 650
            +K+  + D+H  +  K+  FAGW MPI Y  SI E  L  R    +FDVSHM  +  +GKD + FL+ +   D++     +GT T+  NE G   D++++  + ++   ++ ++   +K  A   +++  ++ FT    ++    +D
Sbjct:    2 VKRVHIFDWHKEHARKIEEFAGWEMPIWYS-SIKEEHLAVRNAVGIFDVSHMGEIVFRGKDALKFLQYVTTNDISKPPAISGTYTLVLNERGAIKDETLVFNMGNNEYLMICDSDAFEKLYAWFTYLKRTIEQFTKLDLEIELKTYD 147          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_PYRAB (Probable aminomethyltransferase OS=Pyrococcus abyssi GN=gcvT PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.532e-11
Identity = 43/146 (29.45%), Postives = 75/146 (51.37%), Query Frame = 3
Query:  222 KKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLA---HIEAHMKSFTAKGGDVSWHIHD 650
            K+  L D+H  +  K+  FAGW MPI Y  SI E  L  R    LFDVSHM  +  +GKD + FL+ +   D++     +G  T+  NE G   D+++I  + ++   ++ ++   +K  A   +++  ++ FT    ++    +D
Sbjct:    3 KRVHLFDWHKEHAKKIEEFAGWEMPIWYS-SIKEEHLAVRNAVGLFDVSHMGEIYFRGKDALKFLQYVTTNDISKPPAISGIYTLVLNERGAIKDETLIFNMGNNEYLMICDSDAFEKLYAWFTYLKKTIEQFTKLDLEIELKTYD 147          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_NOCFA (Aminomethyltransferase OS=Nocardia farcinica GN=gcvT PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.532e-11
Identity = 38/115 (33.04%), Postives = 56/115 (48.70%), Query Frame = 3
Query:  216 NLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNA 560
            +L +  +HD H   G     F GW MP+ Y  ++ E     R    LFDVSH+   ++ G     F+   +  D+  + PG    T+  + +GG IDD +   V DD I+LV NA
Sbjct:    5 DLLRGPVHDLHGELGATFAEFGGWQMPVAYAGTVGEHQA-VRTTVGLFDVSHLGKATVAGPGAAQFVNATLTNDLGRIHPGKAQYTLCCSADGGVIDDLIAYYVADDEIFLVPNA 118          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_HALSA (Probable aminomethyltransferase OS=Halobacterium salinarium GN=gcvT PE=3 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.000e-11
Identity = 42/134 (31.34%), Postives = 63/134 (47.01%), Query Frame = 3
Query:  219 LKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDD---HIYLVVNAG----CRDKDLAHIEAH 599
            L+ + LH  H   G     F GW+MP+ + D I       R+   +FDVSHM  + + G D    +++L   DV+ L PG       T+++G  IDD+V+ +   D       V NAG      D+   H +AH
Sbjct:    3 LRTSPLHGRHEDRGASFTEFGGWNMPVDF-DGIQAEHAAVREAAGIFDVSHMGEIEVSGPDAERLMQRLTTNDVSRLDPGDAQYAAITDDDGIMIDDTVVYRTPADWPGAFLFVPNAGHDAAAFDRWTDHRDAH 135          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_HALS3 (Probable aminomethyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gcvT PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.000e-11
Identity = 42/134 (31.34%), Postives = 63/134 (47.01%), Query Frame = 3
Query:  219 LKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDD---HIYLVVNAG----CRDKDLAHIEAH 599
            L+ + LH  H   G     F GW+MP+ + D I       R+   +FDVSHM  + + G D    +++L   DV+ L PG       T+++G  IDD+V+ +   D       V NAG      D+   H +AH
Sbjct:    3 LRTSPLHGRHEDRGASFTEFGGWNMPVDF-DGIQAEHAAVREAAGIFDVSHMGEIEVSGPDAERLMQRLTTNDVSRLDPGDAQYAAITDDDGIMIDDTVVYRTPADWPGAFLFVPNAGHDAAAFDRWTDHRDAH 135          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_STRAW (Aminomethyltransferase OS=Streptomyces avermitilis GN=gcvT PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.613e-11
Identity = 38/145 (26.21%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  222 KKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDER 656
            + TAL   H + G  M  FAGW MP++Y  S  +  L  R    LFD+SHM  +++ G      L   ++ ++A +  G    T+    +GG +DD ++ ++++    +V NA       ++ +  + + T + G     + D+R
Sbjct:    7 RHTALDALHRSLGATMTDFAGWDMPLRY-GSERDEHLAVRSKAGLFDLSHMGEITVTGPGAAALLNYALVGNIASVGVGRARYTMICRADGGILDDLIVYRLQEQTYLVVANA-------SNAQVVLDALTERAGGFDAVVRDDR 143          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_FRASN (Aminomethyltransferase OS=Frankia sp. (strain EAN1pec) GN=gcvT PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.412e-11
Identity = 36/115 (31.30%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  219 LKKTALHDFHVANGGKMVPFAGWSMPIQYKD-SIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNA 560
            L+++ LH+ HV  G K   F GW MPI+Y    ++      R    +FDVSH+    + G     F+   +  D+  + PG    T+  +E GG +DD +      D+++LV NA
Sbjct:    4 LRRSPLHERHVELGAKTAAFGGWEMPIEYAGRGVLAEHAAVRGAVGIFDVSHLGKARVAGPGAAEFVNTCLTNDLRRVGPGQAQYTLCCDETGGVVDDLIAYYYAVDNVFLVPNA 118          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_FRAAA (Aminomethyltransferase OS=Frankia alni (strain ACN14a) GN=gcvT PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.412e-11
Identity = 38/128 (29.69%), Postives = 62/128 (48.44%), Query Frame = 3
Query:  216 NLKKTALHDFHVANGGKMVPFAGWSMPIQYKD-SIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEA 596
            +L+++ L+  HV  G KM  F GW MPI+Y    ++      R    +FDVSH+    + G     F+   +  D+  +APG    T+  N+ GG +DD +      + + LV NA    + +A + A
Sbjct:    3 DLRRSPLYGRHVDLGAKMAGFGGWEMPIEYAGRGVLAEHQAVRGAVGIFDVSHLGKAEVTGAGAAEFVNACLSNDLGRIAPGQAQYTLCCNDEGGVVDDLIAYLFSGERVLLVPNAANNAEVVARLAA 130          
The following BLAST results are available for this feature:
BLAST of FC875475 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 328
Match NameE-valueIdentityDescription
GCST_PYRHO8.980e-1227.89Probable aminomethyltransferase OS=Pyrococcus hori... [more]
GCST_PYRAB1.532e-1129.45Probable aminomethyltransferase OS=Pyrococcus abys... [more]
GCST_NOCFA1.532e-1133.04Aminomethyltransferase OS=Nocardia farcinica GN=gc... [more]
GCST_HALSA2.000e-1131.34Probable aminomethyltransferase OS=Halobacterium s... [more]
GCST_HALS32.000e-1131.34Probable aminomethyltransferase OS=Halobacterium s... [more]
GCST_STRAW2.613e-1126.21Aminomethyltransferase OS=Streptomyces avermitilis... [more]
GCST_FRASN3.412e-1131.30Aminomethyltransferase OS=Frankia sp. (strain EAN1... [more]
GCST_FRAAA3.412e-1129.69Aminomethyltransferase OS=Frankia alni (strain ACN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D02EF CTVClemen1 Citrus clementina cDNA clone C31404D02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875475 ID=FC875475|Name=FC875475|organism=Citrus clementina|type=EST|length=665bp
GGATCCACCGCTCTCTCTGTGTATGCCTGGAGATGCTCTTTCGGGCTCCC
AGATTTGCTTGTTTCTGAGATAAAGAAGAAAACCCCATCTCTATATTTAT
ATCGAATAAAATGAGAGGAGGGAGTCTGTGGCAGCTTGGACAATCGATCA
CCCGTCGTTTGGCTCTGGCTGATAAGAAGACTATAGCTCGTAGACACTTT
GCCTCAGATGCTGAAAACCTGAAAAAAACTGCCCTTCATGACTTTCATGT
GGCTAATGGTGGAAAGATGGTTCCATTTGCTGGATGGAGCATGCCTATTC
AGTACAAGGACTCAATTATGGAATCTACTTTGAATTGTCGGCAGAATGGT
AGTCTCTTTGATGTCTCCCATATGTGTGGGCTGAGCCTCAAAGGGAAGGA
TTGCGTCCCTTTCCTTGAGAAGCTTGTGATCGCTGATGTTGCTGGACTTG
CCCCAGGAACTGGGACTCTTACAGTCTTTACAAATGAAAATGGGGGTTCA
ATTGATGATTCGGTTATTACCAAGGTGAAGGATGATCACATATACCTTGT
TGTGAATGCTGGCTGCAGGGATAAGGATCTTGCTCACATTGAGGCACATA
TGAAGAGTTTCACAGCCAAAGGTGGGGATGTCTCGTGGCACATCCATGAT
GAGAGATCTCTTCTT
back to top