FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_MESSB (60 kDa chaperonin 2 OS=Mesorhizobium sp. (strain BNC1) GN=groL2 PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.677e-66
Identity = 124/216 (57.41%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  ML+GV  +A AVKVT+GPKGRNV+I+KS G P++TKDGVTVA  IE  DK +++GA +V++VA  TN AAGDGTT ATVLTQAI+ EG K+VA+G+N MDL+ GI  A++A++ +LK  A+ ++  +EI QV TISANG++EIG  LA+AMEKVG EGVITV +  T   ELE V GM+  RGY+SPYF+T+ +  + EL+ P
Sbjct:    3 AKDVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDAAGDGTTTATVLTQAIVKEGAKAVASGMNPMDLKRGIDKAVEAIVEELKKNARKVTKNDEIAQVGTISANGDQEIGRFLAQAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQEKMRVELDEP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_NITWN (60 kDa chaperonin 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL1 PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.677e-66
Identity = 126/216 (58.33%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++AV+ DL   A+ I++  EI QVATISANG+ EIG  LA AM+KVG EGVITV +  ++  ELE V GM+  RGY+SPYFVTD +  + E E+P
Sbjct:    3 AKEVRFSSDAREKMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELDDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGIDLAVEAVVKDLTKNAKKITSNSEIAQVATISANGDTEIGRFLAEAMQKVGNEGVITVEEAKSLETELEVVEGMQFDRGYVSPYFVTDAEKMRVEFEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_METRJ (60 kDa chaperonin OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=groL PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 7.414e-66
Identity = 124/216 (57.41%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI +A  A + D+ +RA+ +ST +E+ QV TISANG++EIGE++A AM+KVG EGVITV +  T   EL+ V GM+  RGY+SPYF+T+ +    ELE+P
Sbjct:    3 AKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGIDLATQAAVKDIIARAKKVSTSDEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNAEKMVAELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_EUGGR (Chaperonin CPN60, mitochondrial OS=Euglena gracilis GN=HSP60 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 7.414e-66
Identity = 129/225 (57.33%), Postives = 167/225 (74.22%), Query Frame = 3
Query:   51 VLCNRNYVAK--DINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            VL  R Y +K  DI FGV AR  ML GV+ +++AV VT+GPKGRNV+IE+  G PK+TKDGVTVA +IEF+D  +++GA LV+QVA  TN+ AGDGTT +TVL   I +EG K+V  G + +D++ GI  A++ V+  L  +++ I + EE+TQVATISANG+ EIG+L+  AMEKVGK GVITV DG T+  ELE V GM L RGYISPYFVT+ KTQK E+E+
Sbjct:    6 VLARRGYSSKGKDILFGVDARVKMLAGVNRLSQAVSVTLGPKGRNVVIEQPFGAPKITKDGVTVAKAIEFKDSFENLGAQLVRQVANTTNEIAGDGTTTSTVLANTIFSEGYKAVTQGTSPVDMKRGIDRAVEVVLQSLTEQSKTIVSKEEVTQVATISANGDVEIGQLIGHAMEKVGKAGVITVSDGKTLDTELEVVEGMSLDRGYISPYFVTNAKTQKVEIED 230          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_METPB (60 kDa chaperonin OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=groL PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 9.683e-66
Identity = 124/216 (57.41%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI +A  A + D+ +RA+ +++ EE+ QV TISANG++EIGE++A AM+KVG EGVITV +  T   EL+ V GM+  RGY+SPYFVT+ +    ELE+P
Sbjct:    3 AKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKFVAAGINPMDLKRGIDLATQAAVKDITARAKKVASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFVTNAEKMVAELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_HAEIG (60 kDa chaperonin OS=Haemophilus influenzae (strain PittGG) GN=groL PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 9.683e-66
Identity = 125/216 (57.87%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNVI++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+S+LK+ ++   T +EI QV TISAN +  +G+L+++AMEKVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   EL+NP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETSKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_HAEIE (60 kDa chaperonin OS=Haemophilus influenzae (strain PittEE) GN=groL PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 9.683e-66
Identity = 125/216 (57.87%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNVI++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+S+LK+ ++   T +EI QV TISAN +  +G+L+++AMEKVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   EL+NP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_HAEI8 (60 kDa chaperonin OS=Haemophilus influenzae (strain 86-028NP) GN=groL PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 9.683e-66
Identity = 125/216 (57.87%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNVI++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+S+LK+ ++   T +EI QV TISAN +  +G+L+++AMEKVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   EL+NP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RHOCS (60 kDa chaperonin OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=groL PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.265e-65
Identity = 123/216 (56.94%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  ARA ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +VK+VA  T   AGDGTT ATVL QAI+ EG K++AAG+N MD++ G+ +A+  V+ D+KSR++ ++T +EI QV TISANGE EIG+++A AM+KVG EGVITV +   +  EL+ V GM+  RGY+SPYFVT+      ELE+P
Sbjct:    3 AKEVKFGSDARAKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELSDKFENMGAQMVKEVAQKTADLAGDGTTTATVLAQAIVREGAKAIAAGMNPMDVKRGVDVAVQTVVDDIKSRSRKVTTNDEIAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKALETELDVVEGMQFDRGYLSPYFVTNADKMVAELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUO2 (60 kDa chaperonin OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=groL PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.652e-65
Identity = 123/215 (57.21%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH602_MESSB5.677e-6657.4160 kDa chaperonin 2 OS=Mesorhizobium sp. (strain B... [more]
CH601_NITWN5.677e-6658.3360 kDa chaperonin 1 OS=Nitrobacter winogradskyi (s... [more]
CH60_METRJ7.414e-6657.4160 kDa chaperonin OS=Methylobacterium radiotoleran... [more]
CH60_EUGGR7.414e-6657.33Chaperonin CPN60, mitochondrial OS=Euglena gracili... [more]
CH60_METPB9.683e-6657.4160 kDa chaperonin OS=Methylobacterium populi (stra... [more]
CH60_HAEIG9.683e-6657.8760 kDa chaperonin OS=Haemophilus influenzae (strai... [more]
CH60_HAEIE9.683e-6657.8760 kDa chaperonin OS=Haemophilus influenzae (strai... [more]
CH60_HAEI89.683e-6657.8760 kDa chaperonin OS=Haemophilus influenzae (strai... [more]
CH60_RHOCS1.265e-6556.9460 kDa chaperonin OS=Rhodospirillum centenum (stra... [more]
CH60_BRUO21.652e-6557.2160 kDa chaperonin OS=Brucella ovis (strain ATCC 25... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top