FC931874
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC931874 vs. ExPASy Swiss-Prot
Match: THIO1_SYNE7 (Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 6.629e-11 Identity = 30/71 (42.25%), Postives = 45/71 (63.38%), Query Frame = 2 Query: 353 VVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGA 565 V++D + WCGPC+++AP E+A++YSD + + EN S+A + GIR +PT I KD + V V GA Sbjct: 23 VLVDFWAPWCGPCRMVAPVVDEIAQQYSDQVKVVKVNTDENPSVASQYGIRSIPTLMIFKDGQRVDTVVGA 93
BLAST of FC931874 vs. ExPASy Swiss-Prot
Match: TRXL2_ARATH (Thioredoxin-like 2, chloroplastic OS=Arabidopsis thaliana GN=At4g26160 PE=2 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 8.658e-11 Identity = 32/83 (38.55%), Postives = 54/83 (65.06%), Query Frame = 2 Query: 272 AGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTF 520 AG + ++T + F +K AGD+ V++D Y WCG C+ + PK + AK++ +++FLK++ + ENKSL K L ++V+P F Sbjct: 91 AGPNMIDITSAEQ--FLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLKVNFD-ENKSLCKSLNVKVLPYF 170
BLAST of FC931874 vs. ExPASy Swiss-Prot
Match: THIO_CYACA (Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.658e-11 Identity = 30/74 (40.54%), Postives = 46/74 (62.16%), Query Frame = 2 Query: 344 DKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGA 565 +K V++D + WCGPC++I+P ELA++Y + + + EN S++ E GIR +PT + KD K V V GA Sbjct: 20 EKLVLVDFWAPWCGPCRMISPVIDELAQEYVEQVKIVKINTDENPSISAEYGIRSIPTLMLFKDGKRVDTVIGA 93 The following BLAST results are available for this feature:
BLAST of FC931874 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 53
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC931874 ID=FC931874; Name=FC931874; organism=Citrus clementina; type=EST; length=711bpback to top |