CK934031
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI2_SOYBN (Ferritin-2, chloroplastic OS=Glycine max PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.309e-11 Identity = 30/41 (73.17%), Postives = 37/41 (90.24%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHEGD 126 EFL EQV++I KIA+YV+QLR+VGKGHG+WHFDQ LLH+ D Sbjct: 215 EFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDED 255
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI1_TOBAC (Ferritin-1, chloroplastic OS=Nicotiana tabacum GN=FER1 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 3.809e-11 Identity = 31/43 (72.09%), Postives = 38/43 (88.37%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHEGDAA 132 EFL EQV+AI KI++YV+QLR VG+GHG+W FDQMLL+EG AA Sbjct: 209 EFLVEQVDAIKKISEYVAQLRRVGQGHGVWQFDQMLLNEGAAA 251 The following BLAST results are available for this feature:
BLAST of CK934031 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK934031 ID=CK934031; Name=CK934031; organism=Citrus sinensis; type=EST; length=484bpback to top |